| Clone Name | FLbaf77e15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q9FK81:Y5258_ARATH Uncharacterized protein At5g22580 - Arabidops... | 101 | 3e-21 | 2 | Q9LUV2:POP3_ARATH Putative Pop3 protein - Arabidopsis thaliana (... | 74 | 5e-13 | 3 | Q45539:CSBB_BACSU Putative glycosyltransferase csbB - Bacillus s... | 32 | 2.3 |
|---|
>Q9FK81:Y5258_ARATH Uncharacterized protein At5g22580 - Arabidopsis thaliana (Mouse-ear| cress) Length = 111 Score = 101 bits (251), Expect = 3e-21 Identities = 47/99 (47%), Positives = 65/99 (65%) Frame = +1 Query: 88 FKHLCLVRFKEGVVVDDIIQQLTKLAAELDTVKFFGWGKDVLNQETLTQGFTHVFSMSFA 267 FKHL +V+FKE VD+I++ L L +++DTVK F WG+D + + L QGFTH FSM+F Sbjct: 6 FKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFE 65 Query: 268 SAEDLAACMGHEKHSAFAATFMAVLDKVVVLDFPFVVAK 384 + + A H H F+A F AV+DK+V+LDFP K Sbjct: 66 NKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVK 104
>Q9LUV2:POP3_ARATH Putative Pop3 protein - Arabidopsis thaliana (Mouse-ear cress)| Length = 109 Score = 73.9 bits (180), Expect = 5e-13 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 3/95 (3%) Frame = +1 Query: 91 KHLCLVRFKEGVV---VDDIIQQLTKLAAELDTVKFFGWGKDVLNQETLTQGFTHVFSMS 261 KH+ L FK+GV ++++I+ L ++ +K F WGKDV + E L QG+TH+F + Sbjct: 9 KHVLLASFKDGVSPEKIEELIKGYANLVNLIEPMKAFHWGKDV-SIENLHQGYTHIFEST 67 Query: 262 FASAEDLAACMGHEKHSAFAATFMAVLDKVVVLDF 366 F S E +A + H H FA F+ LDKV+V+D+ Sbjct: 68 FESKEAVAEYIAHPAHVEFATIFLGSLDKVLVIDY 102
>Q45539:CSBB_BACSU Putative glycosyltransferase csbB - Bacillus subtilis| Length = 329 Score = 32.0 bits (71), Expect = 2.3 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 130 VDDIIQQLTKLAAELDTVKFFGWGKDVLNQETLTQGFTHV 249 VDD +QQ+ LAA VK+ + ++ + + GF HV Sbjct: 47 VDDTLQQIKDLAATCSRVKYISFSRNFGKEAAILAGFEHV 86 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 101,544,017 Number of extensions: 1978396 Number of successful extensions: 4664 Number of sequences better than 10.0: 3 Number of HSP's gapped: 4662 Number of HSP's successfully gapped: 3 Length of query: 233 Length of database: 100,686,439 Length adjustment: 110 Effective length of query: 123 Effective length of database: 70,513,989 Effective search space: 8673220647 Effective search space used: 8673220647 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)