ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf50l02 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os11g26790:12011.t02293:unspliced-genomic water stress-inducible protein Rab21, putative, expressed| Length = 1294 Score = 51.5 bits (106), Expect(4) = 2e-20 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +3 / +2 Query: 519 TGEKKGIMDKIKEKLPGQH*A 581 TGEKKGIMDKIKEKLPGQH*A Sbjct: 824 TGEKKGIMDKIKEKLPGQH*A 886 Score = 39.6 bits (80), Expect(4) = 2e-20 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +3 / +2 Query: 135 KMEFQGQHDNPANRVDEYGNP 197 +ME QGQH + +RVDEYGNP Sbjct: 275 RMEHQGQHGHVTSRVDEYGNP 337 Score = 37.7 bits (76), Expect(4) = 2e-20 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 / +3 Query: 208 PAAWGERTPLPAPAGSSRPAGRSTRPVGYC 297 PAAWG P A SS GRSTRP C Sbjct: 426 PAAWGRTAPPAPAAASSSR*GRSTRPAASC 515 Score = 30.9 bits (61), Expect(4) = 2e-20 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +2 / +1 Query: 380 DQGEAPRRPQGQPAA 424 DQGEAPRR QG+ AA Sbjct: 682 DQGEAPRRQQGRAAA 726 Score = 43.2 bits (88), Expect(3) = 6e-13 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 / -2 Query: 580 AQCCPGSFSLILSMIPFFS 524 AQC PGSFSLILSM+PFFS Sbjct: 885 AQCWPGSFSLILSMMPFFS 829 Score = 42.3 bits (86), Expect(3) = 6e-13 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 / -2 Query: 196 GLPYSSTRLAGLSCCPWNSIL 134 GLPYSSTRL CCPW SIL Sbjct: 336 GLPYSSTRLVTWPCCPWCSIL 274 Score = 30.4 bits (60), Expect(3) = 6e-13 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 / -2 Query: 301 RCSIPRVLCSSLRAWN 254 RC P VLCSSL WN Sbjct: 519 RCRTPPVLCSSLIGWN 472 Score = 32.2 bits (64), Expect(2) = 0.003 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 / +1 Query: 527 EEGDHGQDQGEAA 565 EEG HGQDQGEAA Sbjct: 832 EEGHHGQDQGEAA 870 Score = 31.8 bits (63), Expect(2) = 0.003 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +3 / +2 Query: 252 QFQARREEHKTRGILHR 302 QFQ REEHKT G+L R Sbjct: 470 QFQPMREEHKTGGVLQR 520 Score = 32.2 bits (64), Expect(2) = 0.13 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 / -2 Query: 568 PGSFSLILSMIPFF 527 PGSFSLI S+IPFF Sbjct: 702 PGSFSLIFSLIPFF 661 Score = 25.8 bits (50), Expect(2) = 0.13 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -2 / -3 Query: 282 SCAPPCGPGTARR 244 SCAPP GT RR Sbjct: 500 SCAPPSSAGTGRR 462 Score = 31.3 bits (62), Expect = 8.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 / +2 Query: 528 KKGIMDKIKEKLPG 569 KKGI +KIKEKLPG Sbjct: 662 KKGIKEKIKEKLPG 703
>LOC_Os11g26760:12011.t02290:unspliced-genomic dehydrin Rab16C, putative, expressed| Length = 890 Score = 51.0 bits (105), Expect(5) = 7e-20 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +3 / +2 Query: 519 TGEKKGIMDKIKEKLPGQH*AAGSG 593 TGEKKG MDKIKEKLPGQH* + +G Sbjct: 608 TGEKKGFMDKIKEKLPGQH*ISSTG 682 Score = 33.6 bits (67), Expect(5) = 7e-20 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +3 / +3 Query: 252 QFQARREEHKTRGILHR 302 QFQ +EEHKT GILHR Sbjct: 231 QFQPVKEEHKTGGILHR 281 Score = 33.1 bits (66), Expect(5) = 7e-20 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 / +3 Query: 144 FQGQHDNPANRVDEYGNP 197 +QGQH A+RVD YGNP Sbjct: 87 YQGQHGYGADRVDVYGNP 140 Score = 32.2 bits (64), Expect(5) = 7e-20 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 / +1 Query: 380 DQGEAPRRPQGQPAAHGDGDWNRR 451 DQGEAPRR QGQ A D R Sbjct: 454 DQGEAPRRQQGQQPAAAADDGEHR 525 Score = 22.6 bits (43), Expect(5) = 7e-20 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +1 / +3 Query: 487 TGSKGTQEWPAPA 525 TGS+GT PAPA Sbjct: 534 TGSRGTPG*PAPA 572 Score = 37.3 bits (75), Expect(4) = 9e-11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 / -3 Query: 574 CCPGSFSLILSMIPFFS 524 C PGSFSLILSM PFFS Sbjct: 663 CWPGSFSLILSMKPFFS 613 Score = 35.0 bits (70), Expect(4) = 9e-11 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -1 / -2 Query: 196 GLPYSSTRLAGLSCCPW 146 GLPY+STR A CCPW Sbjct: 139 GLPYTSTRSAP*PCCPW 89 Score = 29.5 bits (58), Expect(4) = 9e-11 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -1 / -2 Query: 301 RCSIPRVLCSSLRAWNC 251 R +P VLCSS WNC Sbjct: 280 RWRMPPVLCSSFTGWNC 230 Score = 22.6 bits (43), Expect(4) = 9e-11 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 / -2 Query: 524 AGAGHSCVPLL 492 AGAGH VPLL Sbjct: 571 AGAGHPGVPLL 539 Score = 32.2 bits (64), Expect(2) = 0.027 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 / -3 Query: 568 PGSFSLILSMIPFF 527 PGSFSLI S+IPFF Sbjct: 474 PGSFSLIFSLIPFF 433 Score = 27.6 bits (54), Expect(2) = 0.027 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 / -3 Query: 282 SCAPPCGPGTARRCR 238 SCAPP GTARR R Sbjct: 261 SCAPPSPAGTARRRR 217 Score = 31.3 bits (62), Expect(2) = 0.067 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 / +2 Query: 528 KKGIMDKIKEKLPG 569 KKGI +KIKEKLPG Sbjct: 434 KKGIKEKIKEKLPG 475 Score = 27.2 bits (53), Expect(2) = 0.067 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +1 / +1 Query: 238 PAPAGSSRPAGRSTRP 285 PAPAGSS RSTRP Sbjct: 217 PAPAGSSSR*RRSTRP 264
>LOC_Os11g26780:12011.t02292:unspliced-genomic dehydrin Rab16B, putative, expressed| Length = 1130 Score = 45.5 bits (93), Expect(4) = 1e-14 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 / +2 Query: 522 GEKKGIMDKIKEKLPGQH* 578 GEKKG MDKIKEKLPGQH* Sbjct: 674 GEKKGFMDKIKEKLPGQH* 730 Score = 34.5 bits (69), Expect(4) = 1e-14 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +3 / +3 Query: 252 QFQARREEHKTRGILHR 302 QFQ RE+HKT GILHR Sbjct: 300 QFQPAREDHKTGGILHR 350 Score = 33.1 bits (66), Expect(4) = 1e-14 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 / +3 Query: 144 FQGQHDNPANRVDEYGNP 197 +QGQH A+RVD YGNP Sbjct: 150 YQGQHGYGADRVDVYGNP 203 Score = 25.8 bits (50), Expect(4) = 1e-14 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +2 / +1 Query: 380 DQGEAPRRPQGQ 415 DQGEA RR QGQ Sbjct: 523 DQGEAARRQQGQ 558 Score = 37.3 bits (75), Expect(3) = 3e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 / -3 Query: 574 CCPGSFSLILSMIPFFS 524 C PGSFSLILSM PFFS Sbjct: 726 CWPGSFSLILSMNPFFS 676 Score = 35.0 bits (70), Expect(3) = 3e-09 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -1 / -2 Query: 196 GLPYSSTRLAGLSCCPW 146 GLPY+STR A CCPW Sbjct: 202 GLPYTSTRSAP*PCCPW 152 Score = 30.4 bits (60), Expect(3) = 3e-09 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 / -3 Query: 282 SCAPPCGPGTARRCRERRALP 220 SC PP GT RR R R LP Sbjct: 330 SCGPPSPAGTGRRRRRRHDLP 268 Score = 31.3 bits (62), Expect(2) = 0.006 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +1 / +1 Query: 223 ERTPLPAPAGSSRPAGRSTRP 285 E P PAPA SS GR+TRP Sbjct: 271 EVMPAPAPAASSSRRGRTTRP 333 Score = 31.3 bits (62), Expect(2) = 0.006 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 / +1 Query: 527 EEGDHGQDQGEAA 565 EEG HGQDQGEAA Sbjct: 679 EEGIHGQDQGEAA 717 Score = 32.2 bits (64), Expect(2) = 1.3 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 / -3 Query: 568 PGSFSLILSMIPFF 527 PGSFSLI S+IPFF Sbjct: 543 PGSFSLIFSLIPFF 502 Score = 22.1 bits (42), Expect(2) = 1.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 / -2 Query: 301 RCSIPRVLCSSLRAWN 254 R +P VL SSL WN Sbjct: 349 RWRMPPVLWSSLAGWN 302 Score = 31.3 bits (62), Expect = 8.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 / +2 Query: 528 KKGIMDKIKEKLPG 569 KKGI +KIKEKLPG Sbjct: 503 KKGIKEKIKEKLPG 544
>LOC_Os11g26570:12011.t02273:unspliced-genomic embryogenic cell protein 40, putative, expressed| Length = 1496 Score = 36.3 bits (73), Expect(4) = 9e-14 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = +3 / +1 Query: 519 TGEKKGIMDKIKEKLPG 569 T EKKG+M+KIKEKLPG Sbjct: 1132 THEKKGMMEKIKEKLPG 1182 Score = 34.5 bits (69), Expect(4) = 9e-14 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +2 / +3 Query: 380 DQGEAPRRPQGQPAA 424 DQGEAPRR QG+PAA Sbjct: 975 DQGEAPRRQQGRPAA 1019 Score = 34.1 bits (68), Expect(4) = 9e-14 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 / +3 Query: 153 QHDNPANRVDEYGNP 197 QH +PA RVDEYGNP Sbjct: 147 QHGHPAARVDEYGNP 191 Score = 32.2 bits (64), Expect(4) = 9e-14 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +3 / +3 Query: 252 QFQARREEHKTRGILHR 302 QFQ REEHKT GIL R Sbjct: 756 QFQPAREEHKTGGILRR 806 Score = 33.6 bits (67), Expect(3) = 2e-06 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 / -1 Query: 568 PGSFSLILSMIPFFS 524 PGSFSLI S+IPFFS Sbjct: 1181 PGSFSLIFSIIPFFS 1137 Score = 33.6 bits (67), Expect(3) = 2e-06 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 / -2 Query: 205 SGNGLPYSSTRLAGLSCC 152 + GLPYSSTR AG CC Sbjct: 199 AATGLPYSSTRAAGWPCC 146 Score = 26.7 bits (52), Expect(3) = 2e-06 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 / -2 Query: 301 RCSIPRVLCSSLRAWN 254 R +P VLCSSL WN Sbjct: 805 RRRMPPVLCSSLAGWN 758 Score = 32.2 bits (64), Expect = 4.6 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 / -1 Query: 568 PGSFSLILSMIPFF 527 PGSFSLI S+IPFF Sbjct: 995 PGSFSLIFSLIPFF 954 Score = 31.3 bits (62), Expect = 8.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 / +1 Query: 528 KKGIMDKIKEKLPG 569 KKGI +KIKEKLPG Sbjct: 955 KKGIKEKIKEKLPG 996
>LOC_Os11g26750:12011.t02289:unspliced-genomic dehydrin Rab16D, putative, expressed| Length = 1339 Score = 49.2 bits (101), Expect(2) = 5e-09 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 / +1 Query: 522 GEKKGIMDKIKEKLPGQH*AA 584 GEKKGI+DKIKEKLPGQH*AA Sbjct: 892 GEKKGIVDKIKEKLPGQH*AA 954 Score = 31.3 bits (62), Expect(2) = 5e-09 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +2 / +3 Query: 380 DQGEAPRRPQGQPAAHGDG 436 DQGEAPRR QGQ A G Sbjct: 729 DQGEAPRRQQGQQPAAAAG 785 Score = 42.3 bits (86), Expect(2) = 2e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 / -3 Query: 583 AAQCCPGSFSLILSMIPFFS 524 AAQC PGSFSLILS +PFFS Sbjct: 953 AAQCWPGSFSLILSTMPFFS 894 Score = 29.0 bits (57), Expect(2) = 2e-05 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 / -3 Query: 184 SSTRLAGLSCCPWNSILPATTTLD 113 S+ LA CCPW SIL + LD Sbjct: 152 SARLLAWPPCCPWYSILAIPSLLD 81 Score = 31.3 bits (62), Expect(2) = 3.5 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 / +1 Query: 528 KKGIMDKIKEKLPG 569 KKGI +KIKEKLPG Sbjct: 709 KKGIKEKIKEKLPG 750 Score = 21.7 bits (41), Expect(2) = 3.5 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 / +1 Query: 135 KMEFQGQHDNPAN 173 +ME+QGQH A+ Sbjct: 103 RMEYQGQHGGHAS 141 Score = 32.2 bits (64), Expect = 4.6 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 / -3 Query: 568 PGSFSLILSMIPFF 527 PGSFSLI S+IPFF Sbjct: 749 PGSFSLIFSLIPFF 708
>LOC_Os02g44870:12002.t04077:unspliced-genomic dehydrin COR410, putative, expressed| Length = 1465 Score = 35.4 bits (71), Expect(2) = 0.005 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 / +1 Query: 525 EKKGIMDKIKEKLPGQH*AAG 587 EKKGI+ KI EKLPG H +G Sbjct: 970 EKKGILGKIMEKLPGYHKGSG 1032 Score = 24.4 bits (47), Expect(2) = 0.005 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 / +3 Query: 380 DQGEAPRRPQ 409 DQGEA RRPQ Sbjct: 819 DQGEAARRPQ 848 Score = 37.7 bits (76), Expect = 0.10 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 / +1 Query: 525 EKKGIMDKIKEKLPGQH 575 EKKG +DKIKEKLPG H Sbjct: 796 EKKGFLDKIKEKLPGGH 846 Score = 32.7 bits (65), Expect = 3.4 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 / -3 Query: 604 GSSQPEPAAQCCPGSFSLILSMIPFF 527 G PA PGSFSLI S+ PFF Sbjct: 614 GGGACSPAWSLWPGSFSLIFSLSPFF 537 Score = 32.2 bits (64), Expect = 4.6 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +3 / +1 Query: 525 EKKGIMDKIKEKLPGQH*AAG 587 +KKG+ +KIKEKLPG AG Sbjct: 535 KKKGLKEKIKEKLPGHKDHAG 597 Score = 31.3 bits (62), Expect = 8.7 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -1 / -3 Query: 568 PGSFSLILSMIPFFS 524 PGSFS+IL IPFFS Sbjct: 1013 PGSFSMILPSIPFFS 969 Score = 31.3 bits (62), Expect = 8.7 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 / -3 Query: 568 PGSFSLILSMIPFFS 524 PGSFSLILS PFFS Sbjct: 839 PGSFSLILSRKPFFS 795
>LOC_Os01g50700:12001.t04504:unspliced-genomic dehydrin family protein, expressed| Length = 4872 Score = 34.5 bits (69), Expect(2) = 0.006 Identities = 13/15 (86%), Positives = 15/15 (100%) Frame = +3 / +3 Query: 525 EKKGIMDKIKEKLPG 569 EKKGI++KIKEKLPG Sbjct: 4578 EKKGIVEKIKEKLPG 4622 Score = 29.9 bits (59), Expect(2) = 0.006 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 / +1 Query: 153 QHDNPANRVDEYGNPFP 203 Q+ NP VD+YGNP P Sbjct: 3925 QYGNPVPPVDQYGNPVP 3975 Score = 32.7 bits (65), Expect(2) = 0.029 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +3 / +3 Query: 525 EKKGIMDKIKEKLPGQH 575 +KK I +KIKEKLPG H Sbjct: 4440 KKKSIKEKIKEKLPGSH 4490 Score = 29.5 bits (58), Expect(2) = 0.029 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +3 / +1 Query: 150 GQHDNPANRVDEYGNPFP 203 G + +P RVD+YGNP P Sbjct: 3892 GVYGHPYPRVDQYGNPVP 3945 Score = 31.3 bits (62), Expect = 8.7 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -1 / -3 Query: 568 PGSFSLILSMIPFFS 524 PGSFSLI S +PFFS Sbjct: 4621 PGSFSLIFSTMPFFS 4577
>LOC_Os10g33650:12010.t02665:unspliced-genomic casein kinase I isoform delta-like, putative, expressed| Length = 5366 Score = 38.6 bits (78), Expect = 0.054 Identities = 15/39 (38%), Positives = 27/39 (69%) Frame = +2 / -1 Query: 653 Q**DEAERNVASDFICVGDTFLYTACVVFMFVCSC*KTI 769 Q**++ R+ ++C G+ FL+T V+F+F+C+ KT+ Sbjct: 3353 Q**NDELRDGKHQYLCWGEHFLFTDSVIFLFLCTSFKTL 3237
>LOC_Os06g18720:12006.t01695:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1550 Score = 37.3 bits (75), Expect = 0.14 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +1 / -1 Query: 208 PAAWGERTPLPAPAGSSRPAGRSTRPV 288 P AWG R P+P+ SSRPA S PV Sbjct: 263 PTAWGPRVRPPSPSSSSRPAVLSPSPV 183
>LOC_Os01g12770:12001.t01143:unspliced-genomic cytochrome P450 71A26, putative, expressed| Length = 2282 Score = 35.9 bits (72), Expect = 0.36 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 / -1 Query: 205 WPAAWGERTPLPAPAGSSRPAGRSTRP 285 WP+ G RTP PA A RP +TRP Sbjct: 401 WPSWAGSRTPCPATASPPRPRPPTTRP 321
>LOC_Os03g55930:12003.t04852:unspliced-genomic 30S ribosomal protein S9, chloroplast precursor, putative,| expressed Length = 1831 Score = 28.6 bits (56), Expect(3) = 0.64 Identities = 11/30 (36%), Positives = 11/30 (36%) Frame = +2 / +1 Query: 392 APRRPQGQPAAHGDGDWNRRSIRAGNWNWW 481 A R P P W RR R G WW Sbjct: 184 ASRSPPPPPRPPSLSRWRRRPPRTGRMRWW 273 Score = 23.5 bits (45), Expect(3) = 0.64 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 / +1 Query: 217 WGERTPLPAPAGSSRPAGRSTR 282 W +P P+P S P STR Sbjct: 64 WRSPSPPPSPTSPSPPPPSSTR 129 Score = 22.1 bits (42), Expect(3) = 0.64 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 / +1 Query: 586 APAGCFLCIATRRSLPVP 639 AP GC A R +PVP Sbjct: 409 APEGCSSTSAMPRCVPVP 462
>LOC_Os06g17260:12006.t01598:unspliced-genomic indole-3-acetate beta-glucosyltransferase, putative, expressed| Length = 1428 Score = 35.0 bits (70), Expect = 0.69 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 / -3 Query: 214 AWGERTPLPAPAGSSRPAGRSTRPVG 291 AW R P P P S+R A RST P G Sbjct: 1144 AWAPRPPRPPPPSSTRSASRSTPPRG 1067
>LOC_Os05g16740:12005.t01444:unspliced-genomic SHR5-receptor-like kinase, putative, expressed| Length = 10213 Score = 34.5 bits (69), Expect = 0.94 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 / +1 Query: 654 NNKMKLNETLPLISSVSGTLFCIQRALCLCLCVLAEKQFRIQVNLF 791 NN E P+ISS+ L I R +C C C + + ++ + +F Sbjct: 7099 NNSSLFAEIFPIISSLEAFLLGIVRTICNCKCKILKSSYQGKKEVF 7236
>LOC_Os11g34090:12011.t02962:unspliced-genomic expressed protein| Length = 3452 Score = 34.5 bits (69), Expect = 0.95 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -2 / -3 Query: 285 GSCAPPCGPGTARRCRERRALPP 217 G+CAPP GP RR RA PP Sbjct: 276 GACAPPWGPARGRRGGRGRATPP 208
>LOC_Os12g05760:12012.t00464:unspliced-genomic luminal-binding protein 5 precursor, putative, expressed| Length = 1627 Score = 29.9 bits (59), Expect(2) = 1.3 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / +2 Query: 446 RRSIRAGNWNWWSL 487 RR++ AG W WWSL Sbjct: 1220 RRALAAGRWWWWSL 1261 Score = 24.9 bits (48), Expect(2) = 1.3 Identities = 9/27 (33%), Positives = 12/27 (44%) Frame = +2 / +3 Query: 380 DQGEAPRRPQGQPAAHGDGDWNRRSIR 460 + E PRR G+P H W +R Sbjct: 924 EDAEQPRRRPGEPPRHQPRQWRLLLLR 1004
>LOC_Os12g10250:12012.t00902:unspliced-genomic protein binding protein, putative, expressed| Length = 1714 Score = 32.2 bits (64), Expect(2) = 1.4 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 / +3 Query: 229 TPLPAPAGSSRPAGRSTRP 285 TP P+PA SS P ++TRP Sbjct: 681 TPTPSPASSSSPTAKTTRP 737 Score = 22.6 bits (43), Expect(2) = 1.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 / +1 Query: 383 QGEAPRRPQGQPAAHG 430 +G PRR G+ A HG Sbjct: 1282 RGPPPRRRDGRGAVHG 1329
>LOC_Os10g36390:12010.t02921:unspliced-genomic monocopper oxidase precursor, putative| Length = 4822 Score = 29.9 bits (59), Expect(2) = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 / -2 Query: 208 PAAWGERTPLPAPAGSSRPAG 270 P WG P P PA SS AG Sbjct: 507 PTGWGSLCPAPRPASSSSGAG 445 Score = 26.3 bits (51), Expect(2) = 1.4 Identities = 8/34 (23%), Positives = 18/34 (52%) Frame = +2 / -2 Query: 2 ARHDPRAVCLSVCHPKSKAS*RHNTSTRSPVQGE 103 A H P C +CH +++ + +T +P++ + Sbjct: 4119 AAHAPGYTCQIICHTRNRNAPHEDTVQSNPIKSK 4018
>LOC_Os12g02540:12012.t00150:unspliced-genomic transposon protein, putative, Mutator sub-class, expressed| Length = 4762 Score = 26.3 bits (51), Expect(2) = 1.8 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +2 / -3 Query: 26 CLSVCHPKSKAS*RHNTSTRSPVQGEESIIQGSSS 130 C S C S +S H T+T + + S SSS Sbjct: 4139 CASACCSSSSSSRHHPTTTETASESSSSSSSSSSS 4035 Score = 24.4 bits (47), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 / -3 Query: 208 PAAWGERTPLPAPAGSSRPA 267 PA+ P PAPA S+ PA Sbjct: 3932 PASPASSPPAPAPAPSAAPA 3873
>LOC_Os09g24440:12009.t02126:unspliced-genomic expressed protein| Length = 16666 Score = 33.6 bits (67), Expect = 1.8 Identities = 18/62 (29%), Positives = 25/62 (40%) Frame = -1 / -2 Query: 733 NARCIQKSVPDTDEIRGNVSFSFILLLNEDHVELEGFDA*LCKGSSQPEPAAQCCPGSFS 554 N R + VP D + + L +E E EGF C P P+ P SFS Sbjct: 16620 NVRVVSTGVPTFDILGSGIRIGAGGLADEVPCESEGFAVFFCSEEETPSPSFCFLPFSFS 16441 Query: 553 LI 548 ++ Sbjct: 16440 IL 16435
>LOC_Os03g08070:12003.t00665:unspliced-genomic copper-transporting ATPase PAA1, putative, expressed| Length = 7119 Score = 28.6 bits (56), Expect(2) = 1.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 / +3 Query: 208 PAAWGERTPLPAPAGSSRPAGRSTRP 285 PAA P P P RP RSTRP Sbjct: 279 PAAQRWPPPAPRPIPPPRPRARSTRP 356 Score = 27.6 bits (54), Expect(2) = 1.9 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 / +2 Query: 589 PAGCFLCIATRRSLP 633 PAGCFL + TR S P Sbjct: 4436 PAGCFLSLCTRISYP 4480
>LOC_Os11g40610:12011.t03603:unspliced-genomic early flowering 4, putative, expressed| Length = 3046 Score = 33.1 bits (66), Expect = 2.4 Identities = 9/24 (37%), Positives = 18/24 (75%) Frame = +3 / +1 Query: 687 LISSVSGTLFCIQRALCLCLCVLA 758 +++S+ G L C+ ++C+C+CV A Sbjct: 346 IVNSIRGVLVCMHISMCMCVCVHA 417
>LOC_Os11g45210:12011.t04049:unspliced-genomic hypothetical protein| Length = 1141 Score = 33.1 bits (66), Expect = 2.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 / -1 Query: 217 WGERTPLPAPAGSSRPAGRSTR 282 W RTP P P+ +RPA RS R Sbjct: 142 WSRRTPRPPPSSPARPARRSHR 77
>LOC_Os09g14210:12009.t01210:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3359 Score = 33.1 bits (66), Expect = 2.5 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 / -3 Query: 205 WPAAWGERTPLPAPAGSSRPAGRSTR 282 WP AW E P P PA R + R+ R Sbjct: 2274 WPHAWRESPPSPPPAPQERTSARTHR 2197
>LOC_Os04g25770:12004.t02284:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2169 Score = 33.1 bits (66), Expect = 2.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 / -3 Query: 205 WPAAWGERTPLPAPAGSSRPAGRSTR 282 WP AW E P P+P ++ + R+ R Sbjct: 595 WPHAWSESPPSPSPVSRAKSSARTRR 518
>LOC_Os04g24860:12004.t02196:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1492 Score = 33.1 bits (66), Expect = 2.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 / -1 Query: 205 WPAAWGERTPLPAPAGSSRPAGRSTR 282 WP AW E P P+P ++ + R+ R Sbjct: 604 WPHAWSESPPSPSPVSRAKSSARTRR 527
>LOC_Os04g02000:12004.t00097:unspliced-genomic Zn-finger, RanBP-type, containing protein, expressed| Length = 5396 Score = 33.1 bits (66), Expect = 2.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 / +3 Query: 208 PAAWGERTPLPAPAGSSRPA 267 P +W TPLP P+GS PA Sbjct: 330 PVSWSTPTPLPTPSGSPAPA 389
>LOC_Os06g05950:12006.t00481:unspliced-genomic expressed protein| Length = 2413 Score = 29.5 bits (58), Expect(2) = 2.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 / -3 Query: 392 APRRPQGQPAAHGDGDWNRRSIRAGNW 472 A RR + AA G W+R ++R G W Sbjct: 95 ARRRARSSAAAAMGGGWDRAAVRFGGW 15 Score = 24.9 bits (48), Expect(2) = 2.5 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 / -3 Query: 232 PLPAPAGSSRPAGRSTRPVGYC 297 P P P+ R +G T P G C Sbjct: 551 PSPPPSSPRRSSGCRTSPTGSC 486
>LOC_Os04g59590:12004.t05415:unspliced-genomic ankyrin-like protein, putative, expressed| Length = 4177 Score = 30.9 bits (61), Expect(2) = 3.0 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 / -2 Query: 21 LSVCLSVIRSPKLAEGTTLQLAVRFREKSPSSKVVVAGK 137 +SVCLSV A +T+ ++RFR ++ VVV G+ Sbjct: 726 VSVCLSVSGGGSSASSSTVTGSIRFRGRAVVVVVVVVGR 610 Score = 24.0 bits (46), Expect(2) = 3.0 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +2 / -1 Query: 701 VGDTFLYTACVVFMFVCSC*KTIQNTSELVSKKKKK 808 + TFL+ A ++ + +I+ T++ +KKKK Sbjct: 361 ISTTFLFVASLIAKQTVTINPSIEQTTQSRRRKKKK 254
>LOC_Os10g05600:12010.t00437:unspliced-genomic thaumatin-like protein 1 precursor, putative, expressed| Length = 2180 Score = 32.7 bits (65), Expect = 3.4 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -3 / +2 Query: 647 RSRGTGRLRRVAMQRKQPAGAGGSVLSRQ 561 R R LRR +R QPAGAGG+++ R+ Sbjct: 677 RQRRARLLRRQPRRRLQPAGAGGAIVLRR 763
>LOC_Os12g05430:12012.t00431:unspliced-genomic 60S ribosomal protein L26-1, putative, expressed| Length = 774 Score = 32.7 bits (65), Expect = 3.4 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +2 / +2 Query: 383 QGEAPRRPQGQPAAHGDGDWNRRSIRAGN 469 QGE PRR QGQ H G RR + G+ Sbjct: 413 QGERPRRRQGQGQVHRRGRGRRRRLAPGD 499
>LOC_Os10g34480:12010.t02744:unspliced-genomic cytochrome P450 86A2, putative, expressed| Length = 4422 Score = 32.7 bits (65), Expect = 3.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 / -2 Query: 276 APPCGPGTARRCRERRALPP 217 APP P + RRCR R A PP Sbjct: 230 APPVTPSSRRRCRRRAAPPP 171
>LOC_Os10g04400:12010.t00325:unspliced-genomic benzoyl-CoA benzyl alcohol/phenylethanol benzoyltransferase, putative| Length = 3199 Score = 32.7 bits (65), Expect = 3.4 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 / -3 Query: 276 APPCGPGTARRCRERRALP 220 APPCG TARR R RR P Sbjct: 2660 APPCGTATARR*RARRRWP 2604
>LOC_Os06g03640:12006.t00256:unspliced-genomic protein binding protein, putative, expressed| Length = 2398 Score = 32.7 bits (65), Expect = 3.4 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 / +2 Query: 208 PAAWGERTPLPAPAGSSRPAGRST 279 P+ W RTP APA SSR A +T Sbjct: 785 PSWWSSRTPRHAPAASSRSAAMAT 856
>LOC_Os04g43660:12004.t03906:unspliced-genomic expressed protein| Length = 2109 Score = 32.7 bits (65), Expect = 3.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 / -1 Query: 282 SCAPPCGPGTARRCRERR 229 SC PPC G RCRE R Sbjct: 1374 SCRPPCSTGRQSRCRETR 1321
>LOC_Os03g39090:12003.t03349:unspliced-genomic hypothetical protein| Length = 1170 Score = 32.7 bits (65), Expect = 3.4 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -2 / +1 Query: 288 HGSCAPPCGPGTARRCRERRAL 223 HGSCA C PG AR RR + Sbjct: 874 HGSCAAVCAPGAARWTPSRRGM 939
>LOC_Os02g33810:12002.t03022:unspliced-genomic hypothetical protein| Length = 689 Score = 32.7 bits (65), Expect = 3.4 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 / +1 Query: 434 GDWNRRSIRAGNWNWW 481 G W R+S R G+W+WW Sbjct: 508 GWWTRQSRRRGSWSWW 555
>LOC_Os02g19770:12002.t01769:unspliced-genomic eukaryotic translation initiation factor 1A, putative, expressed| Length = 848 Score = 32.7 bits (65), Expect = 3.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 / +3 Query: 380 DQGEAPRRPQGQPAAHGDGDWNRRSIRAGNW 472 D+G RR +G+ G G RR+ R+G+W Sbjct: 39 DRGRGCRRTRGREGRTGSGGRTRRTTRSGSW 131
>LOC_Os03g12170:12003.t01016:unspliced-genomic hypothetical protein| Length = 1569 Score = 27.6 bits (54), Expect(2) = 4.1 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -3 / +1 Query: 641 RGTGRLRRVAMQRKQPAGA 585 RG G RRV QR+QP GA Sbjct: 289 RGGGCRRRVRDQRRQPGGA 345 Score = 25.4 bits (49), Expect(2) = 4.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -2 / +1 Query: 297 AVSHGSCAPPCGPGTARRCRERRALPP 217 A H PP RRCR RR P Sbjct: 814 APGHRRPLPPLAASCVRRCRSRRRPHP 894
>LOC_Os01g45040:12001.t03963:unspliced-genomic conserved hypothetical protein| Length = 3760 Score = 25.8 bits (50), Expect(2) = 4.3 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 / +1 Query: 226 RTPLPAPAGSSRPAGRSTRPVG 291 R P P RPAGR+ P G Sbjct: 3385 RRPCPCRRSQPRPAGRAASPRG 3450 Score = 23.5 bits (45), Expect(2) = 4.3 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +2 / +2 Query: 398 RRPQGQPAAHGDGDWNRRSIRAGNWN 475 R P A HG R RAG W+ Sbjct: 3566 REPPRDVARHGHRAGRSRQWRAGGWS 3643
>LOC_Os06g43590:12006.t04049:unspliced-genomic charged multivesicular body protein 1b, putative, expressed| Length = 3167 Score = 26.3 bits (51), Expect(2) = 4.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 / +3 Query: 226 RTPLPAPAGSSRPAGRST 279 R P PAP S RP RST Sbjct: 585 RAPWPAPPRSPRPRPRST 638 Score = 23.1 bits (44), Expect(2) = 4.4 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 / +1 Query: 78 QLAVRFREKSPSSKVVVAGKMEFQGQHDNPANRVDEYGNP 197 +L R R ++P AG + GQH A +G P Sbjct: 391 RLPPRRRRRAPRHPGEDAGHRQVHGQHRQVARLRARHGEP 510
>LOC_Os03g04920:12003.t00367:unspliced-genomic multidrug resistance-associated protein 5, putative, expressed| Length = 6667 Score = 32.2 bits (64), Expect = 4.6 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 / -2 Query: 638 GTGRLRRVAMQRKQPAGAGGS 576 G GR R A +R+QP GAGGS Sbjct: 672 GRGRAARRARRRRQPPGAGGS 610
>LOC_Os01g63060:12001.t05677:unspliced-genomic expressed protein| Length = 5050 Score = 32.2 bits (64), Expect = 4.6 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +3 / -1 Query: 672 NETLPLISSVSGTLFCIQRALCLCLCVLAEKQFRIQVNLFQKKK 803 NETL ++ + TL C + A+ L ++A Q RI +NL ++++ Sbjct: 3931 NETLSYQATTTSTL*CFREAIIRRL*IIAISQARILINLTKQEQ 3800
>LOC_Os11g29540:12011.t02558:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1239 Score = 32.2 bits (64), Expect = 4.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 / -3 Query: 205 WPAAWGERTPLPAPAGSSRPAGRSTR 282 WP AW PLP PA +R + R+ R Sbjct: 385 WPHAWRGSPPLPPPALRARTSARTRR 308
>LOC_Os09g32150:12009.t02831:unspliced-genomic expressed protein| Length = 2112 Score = 32.2 bits (64), Expect = 4.6 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 / +3 Query: 298 CSIPRVLCSSLRAWN 254 C IPRV+C+S+ +WN Sbjct: 837 CEIPRVICASVNSWN 881
>LOC_Os08g39730:12008.t03704:unspliced-genomic cytochrome P450 76C2, putative, expressed| Length = 1711 Score = 32.2 bits (64), Expect = 4.6 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 / +2 Query: 760 SARTHKHKHNARCIQKSVPDTDEIRGNVSFSFILLLNED 644 +AR KH+ R ++VPDT +RG S I L + D Sbjct: 278 AAREAFTKHDRRLAARAVPDTSRVRGFADRSMIWLPSSD 394
>LOC_Os02g49690:12002.t04553:unspliced-genomic amino acid binding protein, putative, expressed| Length = 1415 Score = 32.2 bits (64), Expect = 4.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 / +3 Query: 208 PAAWGERTPLPAPAGSSRPAGRSTRPVG 291 PAA R P P PAG PA RP G Sbjct: 174 PAAASRRAPPPCPAGQGLPAPGRPRPPG 257
>LOC_Os02g42290:12002.t03814:unspliced-genomic ATP-dependent Clp protease proteolytic subunit, putative, expressed| Length = 2504 Score = 32.2 bits (64), Expect = 4.6 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 / +2 Query: 395 PRRPQGQPAAHGDGDWNRRSIRAGNWNW 478 PRR P + G G RR R G W W Sbjct: 155 PRRSPPSPPSPGRGPARRRGPRCGGWRW 238
>LOC_Os02g30480:12002.t02741:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3658 Score = 32.2 bits (64), Expect = 4.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 / -3 Query: 205 WPAAWGERTPLPAPAGSSRPAGRSTR 282 WP AW E P P+PA + + R+ R Sbjct: 3551 WPRAWRESPPSPSPAPQEKRSTRTRR 3474
>LOC_Os01g47970:12001.t04243:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2481 Score = 32.2 bits (64), Expect = 4.6 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 / -1 Query: 208 PAAWGERTPLPAPAGSSRPAGRS 276 P AWG R P+P SSRPA S Sbjct: 885 PTAWGPRVRPPSPPTSSRPAPSS 817
>LOC_Os05g49480:12005.t04381:unspliced-genomic expressed protein| Length = 1329 Score = 27.2 bits (53), Expect(2) = 4.7 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 / -2 Query: 386 GEAPRRPQGQPAAHGDGDWNRRSIR 460 G A R P+G A DG+ NR S+R Sbjct: 95 GSARRWPRGGAARATDGEMNRCSVR 21 Score = 22.1 bits (42), Expect(2) = 4.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 / -2 Query: 220 GERTPLPAPAGSSRPA 267 G R+P PAP +RP+ Sbjct: 254 GGRSPPPAPPRRARPS 207
>LOC_Os04g33580:12004.t03034:unspliced-genomic insoluble protein, putative| Length = 1008 Score = 28.6 bits (56), Expect(2) = 5.0 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 / +2 Query: 383 QGEAPRRPQGQPAAHGDGDWNRRSIRAGNWNWWS 484 Q +RP AAHG G W R W W+ Sbjct: 902 QRATTKRPLAVAAAHGGGGWWPRQRSPEAWRPWT 1003 Score = 23.5 bits (45), Expect(2) = 5.0 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 / +2 Query: 208 PAAWGERTPLPAPAGSSRPAGR 273 P A P P+P+ RP+GR Sbjct: 59 PHASAAAAPSPSPSPRRRPSGR 124
>LOC_Os12g08790:12012.t00760:unspliced-genomic expressed protein| Length = 1120 Score = 28.6 bits (56), Expect(2) = 5.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 / -3 Query: 208 PAAWGERTPLPAPAGSSRPAGRSTRPVG 291 P A G RTP P P + P G P G Sbjct: 413 PTATGPRTPSPPP*TTPAPPGTRRAPAG 330 Score = 23.5 bits (45), Expect(2) = 5.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 / -1 Query: 150 GQHDNPANRVDEYGNP 197 G+ D A RVDE G P Sbjct: 700 GEGDEVAERVDEAGGP 653
>LOC_Os03g43880:12003.t03778:unspliced-genomic patatin-like protein, putative, expressed| Length = 1599 Score = 28.1 bits (55), Expect(2) = 5.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 / -2 Query: 285 GSCAPPCGPGTARRC 241 G+ +PPC PG AR C Sbjct: 1109 GARSPPCWPGCARSC 1065 Score = 24.4 bits (47), Expect(2) = 5.6 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -2 / -2 Query: 120 PWMMDSSP*TGLRVEVLCLQLALDF 46 PW SSP +V ++C+++ LD+ Sbjct: 92 PWPSASSPLPMPKVVLVCVRIGLDW 18
>LOC_Os08g39694:12008.t03701:unspliced-genomic cytochrome P450 76C2, putative, expressed| Length = 13081 Score = 31.8 bits (63), Expect = 6.4 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -1 / +1 Query: 760 SARTHKHKHNARCIQKSVPDTDEIRGNVSFSFILLLNED 644 +AR KH+ R ++VPDT RG S S I L + D Sbjct: 11623 AAREAFTKHDRRLAARAVPDTTRARGFASRSMIWLPSSD 11739
>LOC_Os07g30030:12007.t02693:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2407 Score = 31.8 bits (63), Expect = 6.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 / -3 Query: 205 WPAAWGERTPLPAPAGSSRPAGRSTR 282 WP AW E P P+PA + + R+ R Sbjct: 1310 WPHAWREFPPSPSPAPQEKTSARTHR 1233
>LOC_Os07g24060:12007.t02103:unspliced-genomic retrotransposon, putative, centromere-specific| Length = 2539 Score = 31.8 bits (63), Expect = 6.4 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 / +2 Query: 291 SHGSCAPPCGPGTARRCRER 232 + GSC P G T+RRCR R Sbjct: 860 ARGSCTPASGSRTSRRCRRR 919
>LOC_Os06g14490:12006.t01324:unspliced-genomic calmodulin-binding heat-shock protein, putative, expressed| Length = 4486 Score = 31.8 bits (63), Expect = 6.4 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 / -1 Query: 273 PPCGPGTARRCRERR 229 PPCG G RRCRE R Sbjct: 466 PPCGGGQRRRCREGR 422
>LOC_Os06g02200:12006.t00114:unspliced-genomic vegetative storage protein, putative, expressed| Length = 2753 Score = 31.8 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 / +3 Query: 445 PEEHTGRELELVEPTGSKGTQEWPA 519 P H G E + T S+GT+ WPA Sbjct: 387 PPTHAGCSTECLSGTASRGTRSWPA 461
>LOC_Os05g40790:12005.t03618:unspliced-genomic VIP2, putative, expressed| Length = 7193 Score = 31.8 bits (63), Expect = 6.4 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 / +2 Query: 205 WPAAWGERTPLPAPAGSSRPAGRSTRPVGYC 297 W A R PAPA +S PA S RP C Sbjct: 6389 WMA*RSTRASAPAPATTSSPASPSARPTRLC 6481
>LOC_Os05g25830:12005.t02238:unspliced-genomic conserved hypothetical protein| Length = 2743 Score = 31.8 bits (63), Expect = 6.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -1 / -1 Query: 586 PAAQCCPGSFSLILSMIP 533 P QCCP SF ++LS++P Sbjct: 1735 PLCQCCPCSFPVLLSVLP 1682
>LOC_Os04g30770:12004.t02762:unspliced-genomic hydrolase, hydrolyzing O-glycosyl compounds, putative, expressed| Length = 1740 Score = 31.8 bits (63), Expect = 6.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 / -2 Query: 285 GSCAPPCGPGTARRCRERRALPP 217 GS +PPC PG RR RR P Sbjct: 893 GSPSPPCSPGRPRRATTRRRSSP 825
>LOC_Os04g23030:12004.t02031:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3525 Score = 31.8 bits (63), Expect = 6.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 / -3 Query: 205 WPAAWGERTPLPAPAGSSRPAGRSTR 282 WP AW E P P PA + + R+ R Sbjct: 1954 WPHAWRESPPSPPPAPQEKTSARTHR 1877
>LOC_Os03g33110:12003.t02903:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2020 Score = 31.8 bits (63), Expect = 6.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 / -3 Query: 205 WPAAWGERTPLPAPAGSSRPAGRS 276 WP AW P P+PA ++P+ R+ Sbjct: 1964 WPHAWRGSPPSPSPAPRAKPSART 1893
>LOC_Os03g13790:12003.t01172:unspliced-genomic TKI1, putative, expressed| Length = 5954 Score = 31.8 bits (63), Expect = 6.4 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 / +3 Query: 190 PYSSTRLAGLSCCPWNSI 137 PYS++R L CC WNS+ Sbjct: 1521 PYSTSRTPHLICCTWNSL 1574
>LOC_Os02g51790:12002.t04760:unspliced-genomic 50S ribosomal protein L29, chloroplast precursor, putative,| expressed Length = 2779 Score = 31.8 bits (63), Expect = 6.4 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 / -2 Query: 208 PAAWGERTPLPAPAGSSRPAGRSTRPV 288 P+AW E P PAP+ S P R P+ Sbjct: 279 PSAWPESPPAPAPSSPSWPRPRRPSPL 199
>LOC_Os02g45490:12002.t04136:unspliced-genomic expressed protein| Length = 3517 Score = 31.8 bits (63), Expect = 6.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 / +3 Query: 175 RLAGLSCCPWNSILPATTTL 116 RL+ CCPW ++P TT L Sbjct: 1047 RLSNCRCCPWR*LVPTTTEL 1106
>LOC_Os02g10140:12002.t00862:unspliced-genomic TGACG-sequence-specific DNA-binding protein TGA-2.1, putative| Length = 2946 Score = 31.8 bits (63), Expect = 6.4 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 / -1 Query: 208 PAAWGERTPLPAPAGSSRPAGRSTR 282 PA+WG R P P P R A R R Sbjct: 1392 PASWGPRAPTPPPTMRRRDASRRRR 1318
>LOC_Os01g74020:12001.t06682:unspliced-genomic ARR1 protein-like, putative, expressed| Length = 1309 Score = 31.8 bits (63), Expect = 6.4 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 / +3 Query: 419 AAHGDGDWNRRSIRAGNWNWW 481 AA G G RRS G+W WW Sbjct: 561 AARGRGWCGRRSCTRGSWRWW 623
>LOC_Os01g57880:12001.t05189:unspliced-genomic early nodulin-like protein 3 precursor, putative, expressed| Length = 1420 Score = 31.8 bits (63), Expect = 6.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 / +1 Query: 205 WPAAWGERTPLPAPAGSSRPAGRST 279 W AW R+P P P SR AGR++ Sbjct: 112 WWRAWWPRSPPPRPRSCSRRAGRAS 186
>LOC_Os01g08550:12001.t00733:unspliced-genomic aminoacyl-tRNA synthetase, putative, expressed| Length = 4417 Score = 31.8 bits (63), Expect = 6.4 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 / -2 Query: 386 GEAPRRPQGQPAAHGDGDWNRRSIRAGNWNWW 481 G P + PA GDW R++ + G + WW Sbjct: 147 GTRPGASRASPARPSCGDWRRQAGKWGKFWWW 52
>LOC_Os06g50100:12006.t04694:unspliced-genomic protein kinase APK1B, chloroplast precursor, putative, expressed| Length = 3280 Score = 26.3 bits (51), Expect(2) = 7.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 / -1 Query: 208 PAAWGERTPLPAPAGSSRPAGRSTR 282 PAA G R P P+ S P+G +R Sbjct: 3025 PAAGGGRRPCRPPSSSVAPSGAPSR 2951 Score = 22.1 bits (42), Expect(2) = 7.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 / -1 Query: 392 APRRPQGQPAA 424 APRRP PAA Sbjct: 2950 APRRPPSSPAA 2918
>LOC_Os10g36180:12010.t02903:unspliced-genomic expressed protein| Length = 1967 Score = 25.8 bits (50), Expect(2) = 8.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 / +3 Query: 232 PLPAPAGSSRPAGRSTRPVG 291 P P+P S RP G S+R G Sbjct: 1200 PPPSPPASRRPGGSSSRTRG 1259 Score = 22.6 bits (43), Expect(2) = 8.2 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 / +1 Query: 88 SGSGRRVHHPR 120 +G RR+HHPR Sbjct: 1180 AGRRRRLHHPR 1212
>LOC_Os07g04310:12007.t00319:unspliced-genomic hypothetical protein| Length = 2462 Score = 31.3 bits (62), Expect = 8.7 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 / -2 Query: 632 GRLRRVAMQRKQPAGAGGSVLS 567 G+LRR A + +QP G GGS ++ Sbjct: 145 GKLRRGAKEERQPRGGGGSAMA 80
>LOC_Os05g03020:12005.t00199:unspliced-genomic transcription factor IIIA, putative, expressed| Length = 3726 Score = 31.3 bits (62), Expect = 8.7 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 / +2 Query: 681 LPLISSVSGTLFCIQRALCLCLC 749 +PL S SG FC ++ L LC C Sbjct: 1058 MPLSRSSSGDFFCCKKLLALCYC 1126
>LOC_Os03g36730:12003.t03141:unspliced-genomic oligosaccharide transporter, putative, expressed| Length = 6529 Score = 31.3 bits (62), Expect = 8.7 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 / +2 Query: 651 FNNKMKLNETLPLISSVSGTLFCIQRALCLC 743 FN + L ETL I+ V TLFC Q + +C Sbjct: 5054 FNIMLVLMETLGFINCVCKTLFCKQSSFIVC 5146
>LOC_Os11g11760:12011.t01063:unspliced-genomic serpin family protein| Length = 1359 Score = 29.5 bits (58), Expect(2) = 8.7 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +3 / +1 Query: 96 REKSPSSKVVVAGKMEFQGQHDNPANRVDEYGNPF 200 R P + VV+ + F+G+ D P N D PF Sbjct: 586 RSVGPETAVVLGNAIYFKGKWDRPFNESDTERKPF 690 Score = 22.1 bits (42), Expect(2) = 8.7 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 / +2 Query: 580 PPAPAGCFLCIATRR 624 PP GCFL + RR Sbjct: 1211 PPP*QGCFLPVCRRR 1255
>LOC_Os11g41550:12011.t03691:unspliced-genomic expressed protein| Length = 2342 Score = 31.3 bits (62), Expect = 8.7 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 / -2 Query: 208 PAAWGERTPLPAPAGSSRPA 267 PA WG RTP A ++RPA Sbjct: 421 PARWGSRTPRSAATATTRPA 362
>LOC_Os10g41430:12010.t03379:unspliced-genomic nuc-1 negative regulatory protein preg, putative, expressed| Length = 2042 Score = 31.3 bits (62), Expect = 8.7 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 / -3 Query: 211 AAWGERTPLPAPAGSSRPAGRSTR 282 AAWG+R AP SSR A R +R Sbjct: 1653 AAWGDRRRAAAPGRSSRSAARRSR 1582
>LOC_Os10g40584:12010.t03298:unspliced-genomic nucleic acid binding protein, putative, expressed| Length = 835 Score = 31.3 bits (62), Expect = 8.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 / -1 Query: 285 GSCAPPCGPGTARRCRERR 229 G+ A PCGPG RR R RR Sbjct: 397 GTPASPCGPGRRRRWRARR 341
>LOC_Os10g30340:12010.t02368:unspliced-genomic alpha-expansin 17 precursor, putative, expressed| Length = 1017 Score = 31.3 bits (62), Expect = 8.7 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 / -3 Query: 208 PAAWGERTPLPAPAGSSRPAGRSTRP 285 PA G RT P P+ +RP+ R T P Sbjct: 169 PACTGSRTRTPRPSSPTRPSRRRTSP 92
>LOC_Os09g08550:12009.t00649:unspliced-genomic F-box domain containing protein, expressed| Length = 1780 Score = 31.3 bits (62), Expect = 8.7 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +1 / -3 Query: 241 APAGSSRPAGRSTRPVG 291 APAG+ RP GRS+R VG Sbjct: 290 APAGACRPGGRSSRGVG 240
>LOC_Os07g14790:12007.t01342:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2863 Score = 31.3 bits (62), Expect = 8.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 / -3 Query: 205 WPAAWGERTPLPAPAGSSRPAGRSTR 282 WP AW E P P PA + + R+ R Sbjct: 2171 WPHAWRESPPSPPPAPQEKMSARTHR 2094
>LOC_Os07g13234:12007.t004680:unspliced-genomic expressed protein| Length = 2790 Score = 31.3 bits (62), Expect = 8.7 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 / -2 Query: 220 GERTPLPAPAGSSRPAGRSTRPVG 291 GER P P P+GS R T PVG Sbjct: 383 GERRPPPVPSGSPPSPPRRTAPVG 312
>LOC_Os06g46510:12006.t04337:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2617 Score = 31.3 bits (62), Expect = 8.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 / -3 Query: 205 WPAAWGERTPLPAPAGSSRPAGRSTR 282 WP AW PLP PA + + R+ R Sbjct: 1904 WPHAWRGSPPLPPPAPQEKTSARTHR 1827
>LOC_Os06g12060:12006.t01083:unspliced-genomic mTERF family protein, expressed| Length = 4117 Score = 31.3 bits (62), Expect = 8.7 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 / -1 Query: 428 GDGDWNRRSIRAGNWNWW 481 GD W RRS W WW Sbjct: 2764 GDAGWRRRSETMRRWRWW 2711
>LOC_Os03g53640:12003.t04684:unspliced-genomic expressed protein| Length = 1667 Score = 31.3 bits (62), Expect = 8.7 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 / +2 Query: 205 WPAAWGERTPLPAPAGSSRPAGRSTRP 285 WP++ TP +P+GSS AG +++P Sbjct: 608 WPSSGEAPTPPRSPSGSSSAAGEASKP 688
>LOC_Os03g38730:12003.t03315:unspliced-genomic mpv17 / PMP22 family protein, expressed| Length = 2557 Score = 31.3 bits (62), Expect = 8.7 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = -2 / +3 Query: 681 TFRSASSYY*MKITWNWKASTRSYA 607 +FRS S YY*+K+ +N+ + RS++ Sbjct: 1692 SFRSRSHYY*IKLVYNYNKAMRSHS 1766
>LOC_Os03g24010:12003.t02096:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2899 Score = 31.3 bits (62), Expect = 8.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 / -3 Query: 205 WPAAWGERTPLPAPAGSSRPAGRSTR 282 WP AW PLP PA + + R+ R Sbjct: 1940 WPHAWRGSPPLPPPAPQEKTSARTHR 1863
>LOC_Os01g11490:12001.t01019:unspliced-genomic RING-H2 finger protein ATL2G precursor, putative| Length = 696 Score = 31.3 bits (62), Expect = 8.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 205 WPAAWGERTPLPAPAGSSRPAGRSTRP 285 W AAW R P SS P GR+ RP Sbjct: 481 WAAAWPPRRRPPRRGISSTPTGRTRRP 401 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 258,221,128 Number of extensions: 3556227 Number of successful extensions: 26043 Number of sequences better than 10.0: 89 Length of query: 269 Length of database: 55,613,886 Length adjustment: 49 Effective length of query: 220 Effective length of database: 52,856,264 Effective search space: 11628378080 Effective search space used: 11628378080 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
