| Clone Name | FLbaf76b20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P09062:ODB2_PSEPU Lipoamide acyltransferase component of branche... | 32 | 4.1 | 2 | Q7VDF1:HIS6_PROMA Imidazole glycerol phosphate synthase subunit ... | 32 | 5.3 |
|---|
>P09062:ODB2_PSEPU Lipoamide acyltransferase component of branched-chain alpha-keto| acid dehydrogenase complex - Pseudomonas putida Length = 423 Score = 32.0 bits (71), Expect = 4.1 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +2 Query: 8 EKSLTPPTRSAFGKYRAIDAVFRRRPQSPLAAPAVHKRAPDEG 136 +K + P A + A V R+ PLA+PAV KRA D G Sbjct: 108 QKDVKPAAYQASASHEAAPIVPRQPGDKPLASPAVRKRALDAG 150
>Q7VDF1:HIS6_PROMA Imidazole glycerol phosphate synthase subunit hisF -| Prochlorococcus marinus Length = 257 Score = 31.6 bits (70), Expect = 5.3 Identities = 31/95 (32%), Positives = 41/95 (43%) Frame = +3 Query: 390 PMLTSALHKEIGSGVVKLALESDTRSARRRLVEEYVWAVFCNGRKAGYSIRRKDASDDEL 569 P L S + GS + +A++ A+RRL E W VF NG RK+ D L Sbjct: 110 PGLVSRGACQFGSQCIVVAID-----AKRRLEESSGWDVFVNG-------GRKNTGLDAL 157 Query: 570 HVMRLLRGVSMGAGVLPAAPEKDGGVPAGPDGELT 674 R + V +GAG + G G D ELT Sbjct: 158 SWAR--KVVELGAGEILLTSMDGDGTQKGYDLELT 190 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 115,419,394 Number of extensions: 2148950 Number of successful extensions: 7111 Number of sequences better than 10.0: 2 Number of HSP's gapped: 7110 Number of HSP's successfully gapped: 2 Length of query: 335 Length of database: 100,686,439 Length adjustment: 114 Effective length of query: 221 Effective length of database: 69,416,809 Effective search space: 15341114789 Effective search space used: 15341114789 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)