| Clone Name | FLbaf61e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P80680:FTRV_MAIZE Ferredoxin-thioredoxin reductase, variable cha... | 135 | 2e-31 | 2 | P38365:FTRV_SPIOL Ferredoxin-thioredoxin reductase, variable cha... | 79 | 2e-14 | 3 | Q55781:FTRV_SYNY3 Ferredoxin-thioredoxin reductase, variable cha... | 47 | 9e-05 | 4 | P24018:FTRV_SYNP6 Ferredoxin-thioredoxin reductase, variable cha... | 41 | 0.008 |
|---|
>P80680:FTRV_MAIZE Ferredoxin-thioredoxin reductase, variable chain - Zea mays (Maize)| Length = 97 Score = 135 bits (341), Expect = 2e-31 Identities = 62/74 (83%), Positives = 69/74 (93%) Frame = +2 Query: 374 APKVGRRVRVTAPLRVYHVVKAPDLDIQGMEGVIKQYVGVWKGKRITANFPFKVEFQLTV 553 APK+GRRVRVTAPLRVYHV+KAPDLDIQGMEGV+KQYV VWKGKR+TANFPFKVEF+L V Sbjct: 15 APKIGRRVRVTAPLRVYHVLKAPDLDIQGMEGVVKQYVCVWKGKRVTANFPFKVEFELAV 74 Query: 554 DTQPKPVKLFVHLR 595 + QPKPV+ F HLR Sbjct: 75 EGQPKPVRFFAHLR 88
>P38365:FTRV_SPIOL Ferredoxin-thioredoxin reductase, variable chain, chloroplast| precursor - Spinacia oleracea (Spinach) Length = 174 Score = 79.3 bits (194), Expect = 2e-14 Identities = 40/73 (54%), Positives = 55/73 (75%), Gaps = 1/73 (1%) Frame = +2 Query: 380 KVGRRVRVTAPLRVYHVVKAPDLDIQ-GMEGVIKQYVGVWKGKRITANFPFKVEFQLTVD 556 KVG +V+V +PL+VYHV K P++++ M GVIKQYVG WKGK I+ N+PFKVE+++ V Sbjct: 94 KVGCKVKVKSPLKVYHVPKLPEVELTPDMVGVIKQYVGFWKGKYISPNYPFKVEYRIDVP 153 Query: 557 TQPKPVKLFVHLR 595 + VKL VHL+ Sbjct: 154 DRGS-VKLVVHLK 165
>Q55781:FTRV_SYNY3 Ferredoxin-thioredoxin reductase, variable chain - Synechocystis| sp. (strain PCC 6803) Length = 75 Score = 47.4 bits (111), Expect = 9e-05 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 2/56 (3%) Frame = +2 Query: 383 VGRRVRVTAPLRVYHVV--KAPDLDIQGMEGVIKQYVGVWKGKRITANFPFKVEFQ 544 VG RVRVT+ + VYH K D+QGMEG + + W+G+ I+AN P V+F+ Sbjct: 3 VGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFE 58
>P24018:FTRV_SYNP6 Ferredoxin-thioredoxin reductase, variable chain - Synechococcus| sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans) Length = 73 Score = 40.8 bits (94), Expect = 0.008 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 5/58 (8%) Frame = +2 Query: 383 VGRRVRVTAPLRVYHVVKAPD-----LDIQGMEGVIKQYVGVWKGKRITANFPFKVEF 541 VG RVRV + VYH PD D++ EG I + W GK I+ANFP+ V F Sbjct: 3 VGDRVRVKESVVVYH---HPDHRNQAFDLKDAEGEIAAILTEWNGKPISANFPYLVSF 57 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 101,445,933 Number of extensions: 1781899 Number of successful extensions: 4827 Number of sequences better than 10.0: 4 Number of HSP's gapped: 4823 Number of HSP's successfully gapped: 4 Length of query: 325 Length of database: 100,686,439 Length adjustment: 113 Effective length of query: 212 Effective length of database: 69,691,104 Effective search space: 14774514048 Effective search space used: 14774514048 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)