| Clone Name | FLbaf74p10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q6FFA9:HEM3_ACIAD Porphobilinogen deaminase - Acinetobacter sp. ... | 33 | 4.0 | 2 | P04526:DPA44_BPT4 DNA polymerase accessory protein 44 - Bacterio... | 33 | 5.3 | 3 | Q5WE05:SYL_BACSK Leucyl-tRNA synthetase - Bacillus clausii (stra... | 32 | 9.0 |
|---|
>Q6FFA9:HEM3_ACIAD Porphobilinogen deaminase - Acinetobacter sp. (strain ADP1)| Length = 311 Score = 33.1 bits (74), Expect = 4.0 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = -3 Query: 1659 PPLGAGALELPCRNSSRYLLDLHASLANLPVS 1564 P +G GAL L CR + + +LDL A LA+ P S Sbjct: 197 PAVGQGALGLECRANDKKILDLIAPLAHQPTS 228
>P04526:DPA44_BPT4 DNA polymerase accessory protein 44 - Bacteriophage T4| Length = 319 Score = 32.7 bits (73), Expect = 5.3 Identities = 25/68 (36%), Positives = 36/68 (52%) Frame = -3 Query: 1653 LGAGALELPCRNSSRYLLDLHASLANLPVSQVSPLSPKDTRDYAYKDGKLYTASKFGTGA 1474 L AG L L N + D+ SL N V Q+ L+PK DY++ GKL A + + Sbjct: 220 LDAGILSL-VTNDRGAIDDVLESLKNKDVKQLRALAPKYAADYSWFVGKL--AEEIYSRV 276 Query: 1473 SQQTIMRM 1450 + Q+I+RM Sbjct: 277 TPQSIIRM 284
>Q5WE05:SYL_BACSK Leucyl-tRNA synthetase - Bacillus clausii (strain KSM-K16)| Length = 804 Score = 32.0 bits (71), Expect = 9.0 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 6/86 (6%) Frame = +3 Query: 363 QKNMSCRLQDWL*CHLLP*FLSFTHTYSLSW-RPICLIHSLKGSLGAVVK-----LLPCD 524 Q+ ++ RL+DWL + W PI +IH GS+ A+ + +LP Sbjct: 403 QRKVTYRLRDWL------------FSRQRYWGEPIPIIHWEDGSMSALDESELPLVLPDL 450 Query: 525 HEVTGSSPGNSLLQKCRERLRTIDPK 602 E+ S G S L ++ L +DPK Sbjct: 451 EEIKPSGTGESPLANAKDWLEVVDPK 476 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 335,746,506 Number of extensions: 7487556 Number of successful extensions: 15153 Number of sequences better than 10.0: 3 Number of HSP's gapped: 15147 Number of HSP's successfully gapped: 3 Length of query: 616 Length of database: 100,686,439 Length adjustment: 119 Effective length of query: 497 Effective length of database: 68,045,334 Effective search space: 33818530998 Effective search space used: 33818530998 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)