| Clone Name | rbastl56h12 |
|---|---|
| Clone Library Name | barley_pub |
>NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (hN2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 28.1 bits (61), Expect = 5.6 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -1 Query: 243 CVCV-------CDRELCRCMNN*GNKGACTTGLIGMRKLSSAGYRSMHRRVQK 106 C+C C ++ C++N G CT GL G + L AG+ ++ V K Sbjct: 706 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDK 758
>NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (Motch B) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2470 Score = 28.1 bits (61), Expect = 5.6 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -1 Query: 243 CVCV-------CDRELCRCMNN*GNKGACTTGLIGMRKLSSAGYRSMHRRVQK 106 C+C C ++ C++N G CT GL G + L AG+ ++ V K Sbjct: 704 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDK 756
>CB024_HUMAN (Q9BV87) Protein C2orf24| Length = 410 Score = 27.7 bits (60), Expect = 7.4 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 5/65 (7%) Frame = -1 Query: 327 SISI*SEHVRRRDLMLLCYPCLLTPELACVCVCDRELC-----RCMNN*GNKGACTTGLI 163 ++++ S V + L L C P P+L C E C +C+ + N +C G + Sbjct: 244 ALAVASVAVIHQSLGLSCTPTPGPPDLGLTSRCLLEPCIPSVPQCLPSPANVSSCLEGSM 303 Query: 162 GMRKL 148 G+R L Sbjct: 304 GLRSL 308
>ADA33_MOUSE (Q923W9) ADAM 33 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 33) Length = 797 Score = 27.7 bits (60), Expect = 7.4 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 7/57 (12%) Frame = -1 Query: 153 KLSSAGYRSMHRRVQKKSLVLPNNEVDGVMFPPALRCFSSSWQT-------SGIVVI 4 KL + GY H R +VL N D + +R F SW SG++V+ Sbjct: 87 KLLAPGYTETHYRPDGHPVVLSPNHTDHCQYHGRVRGFRESWVVLSTCSGMSGLIVL 143
>PLCG1_RAT (P10686) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase| gamma 1 (EC 3.1.4.11) (Phosphoinositide phospholipase C) (PLC-gamma-1) (Phospholipase C-gamma-1) (PLC-II) (PLC-148) Length = 1290 Score = 27.7 bits (60), Expect = 7.4 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 54 PEGTSHHRLHYWAKQGIFSAHDDALTGSQLS*ASACRSDPSCTHPYC 194 PE ++ HYW I S+H+ LTG Q S S+ + C C Sbjct: 319 PETMNNPLSHYW----ISSSHNTYLTGDQFSSESSLEAYARCLRMGC 361
>APEA_THENE (O86957) Probable M18-family aminopeptidase 1 (EC 3.4.11.-)| Length = 452 Score = 27.3 bits (59), Expect = 9.6 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 39 KNNGGPEGTSHHRLHYWAKQGIFS 110 K GGPE + H + YW K + S Sbjct: 303 KIQGGPEIQNSHSMRYWKKSAVIS 326
>RW1_DROME (Q9V7H4) RW1 protein homolog| Length = 1567 Score = 27.3 bits (59), Expect = 9.6 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -1 Query: 147 SSAGYRSMHRRV-QKKSLVLPNNEVDGVMFPPALRCFSSSWQTSGIV 10 + G+R R+ QK + N P AL+C S+ W+TS V Sbjct: 1305 AGVGFRKPERKQRQKLNFGQTTNSTSPPESPDALKCISNPWETSSRV 1351
>KLDC4_HUMAN (Q8TBB5) Kelch domain-containing protein 4| Length = 520 Score = 27.3 bits (59), Expect = 9.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 39 KNNGGPEGTSHHRLHYWAKQ 98 K+ GGP G S HR+ W +Q Sbjct: 169 KSTGGPSGRSGHRMVAWKRQ 188
>KPTA_BURS3 (Q395F2) Probable RNA 2'-phosphotransferase (EC 2.7.-.-)| Length = 194 Score = 27.3 bits (59), Expect = 9.6 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 148 ELPHADQTRRARTLIALIIHAPAQLSV 228 ELP D TR +RTL L+ HAP + + Sbjct: 7 ELPAPDATRISRTLSYLLRHAPQTIGL 33 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,819,754 Number of Sequences: 219361 Number of extensions: 1009544 Number of successful extensions: 2380 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2378 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)