| Clone Name | rbastl56c07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MTAL2_PICAN (Q707Y8) Mating-type protein ALPHA2 (MATalpha2 trans... | 30 | 1.9 | 2 | GR98B_DROME (Q9VB26) Putative gustatory receptor 98b | 28 | 7.1 |
|---|
>MTAL2_PICAN (Q707Y8) Mating-type protein ALPHA2 (MATalpha2 transcription| factor) Length = 163 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 136 DKTVAIQKELCFHISQDTRLPPNDI 210 ++T+ I KEL ++QDTR PND+ Sbjct: 138 ERTLTISKELSDLLNQDTRCSPNDV 162
>GR98B_DROME (Q9VB26) Putative gustatory receptor 98b| Length = 403 Score = 27.7 bits (60), Expect = 7.1 Identities = 18/70 (25%), Positives = 30/70 (42%) Frame = -2 Query: 357 CCTISKCTILPSIVANHCTNEHHCLTARAHIIRNWSICFKIYPPFHGL*NVIWR*SRVLR 178 C T+ +LP +++ C N ++C H IR C P F L + S + Sbjct: 297 CSTLLVNLLLPCLLSQRCINAYNCFPRILHKIR----CTSADPNFAMLTRGLREYSLQME 352 Query: 177 YVKTQFFLDG 148 ++K +F G Sbjct: 353 HLKLRFTCGG 362 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,806,769 Number of Sequences: 219361 Number of extensions: 891780 Number of successful extensions: 1707 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1707 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)