| Clone Name | rbastl56b11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MATK_DROLU (Q5J2U8) Maturase K (Intron maturase) | 28 | 8.0 |
|---|
>MATK_DROLU (Q5J2U8) Maturase K (Intron maturase)| Length = 514 Score = 27.7 bits (60), Expect = 8.0 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 8/35 (22%) Frame = +2 Query: 2 FFFICRQKES*QDTFYVA--------GQLEHIISL 82 FFFIC Q Q TFY + G++EH++ + Sbjct: 224 FFFICNQSSHLQSTFYGSLIERIHFYGKVEHLVKV 258 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,341,326 Number of Sequences: 219361 Number of extensions: 537596 Number of successful extensions: 928 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 928 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)