| Clone Name | rbastl56b06 |
|---|---|
| Clone Library Name | barley_pub |
>RAD54_SCHPO (P41410) DNA repair protein rhp54 (EC 3.6.1.-) (RAD54 homolog 1)| Length = 852 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +3 Query: 105 IAQVTTLQHMI*TASRKQTALLEFMHGEPGKTFKTPKAPCII 230 I Q TT + I T+S+ T L + PGK FK K P ++ Sbjct: 2 IQQPTTAKPRISTSSKLNTVLSKNKENVPGKLFKKFKCPSLV 43
>Y2986_OCEIH (Q8EM72) UPF0340 protein OB2986| Length = 181 Score = 28.9 bits (63), Expect = 3.4 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 193 GKHLKHPKHPVSFVKPFMTYVSAEVKAATTDP 288 G HLKH P+ F + F+ Y A V+AA T P Sbjct: 140 GMHLKHVAVPLKFKQRFINY--ARVRAARTRP 169
>SEN22_ARATH (Q9LSS3) tRNA-splicing endonuclease subunit Sen2-2 (EC 3.1.27.9)| (AtSen2) (tRNA-intron endonuclease Sen2-2) Length = 250 Score = 28.5 bits (62), Expect = 4.5 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = -2 Query: 167 QRSLLSTCSLNHMLQCCNLSNKLINFPLEQLFFVSFNK*CMKHLLA*GCL 18 Q LL C ++ K I E+ FF+ +N C+K L CL Sbjct: 52 QAELLDRCCFGRLVLSAEKIKKWIQLSFEEAFFLHYNLKCIKISLQGRCL 101
>PHPA_PLACH (Q02752) Acidic phosphoprotein precursor (50 kDa antigen)| Length = 441 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -2 Query: 308 SVAFGTTGSVVAALTSADT*VMNGFTNDTGCFGCFKCFP 192 +++ G S++ ++ A +G + TGCFGCF+ P Sbjct: 3 AISLGLISSIIFSIVLAKN--SSGSGSSTGCFGCFRKKP 39
>NAPA_PASMU (Q9CKL8) Periplasmic nitrate reductase precursor (EC 1.7.99.4)| Length = 828 Score = 27.7 bits (60), Expect = 7.6 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 177 MHGEPGKTFKTPKAPCIICETIHDLCVGRSQGR 275 + P K K KAPC C T + VG GR Sbjct: 30 VEASPDKIIKWDKAPCRFCGTGCSVLVGTQNGR 62
>UBP2_HUMAN (O75604) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 605 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/31 (35%), Positives = 23/31 (74%) Frame = -2 Query: 164 RSLLSTCSLNHMLQCCNLSNKLINFPLEQLF 72 R+L +TC +N +LQC + + +L ++ L++L+ Sbjct: 270 RNLGNTCFMNSILQCLSNTRELRDYCLQRLY 300
>SKN1_CAEEL (P34707) Protein skinhead-1| Length = 623 Score = 27.7 bits (60), Expect = 7.6 Identities = 25/78 (32%), Positives = 34/78 (43%), Gaps = 4/78 (5%) Frame = -2 Query: 293 TTGSVVAALTSADT*----VMNGFTNDTGCFGCFKCFPWFTMHKF*QRSLLSTCSLNHML 126 T S VA LT+ + + GF N G F F + H+ QR + T +L H Sbjct: 225 TEKSTVAPLTAEENARYEDLSKGFYN--GFFESFNNNQYQQKHQQQQREQIKTPTLEHPT 282 Query: 125 QCCNLSNKLINFPLEQLF 72 Q L + L + L QLF Sbjct: 283 QKAELEDDLFDEDLAQLF 300
>UBP2_MOUSE (O88623) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 353 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/31 (35%), Positives = 23/31 (74%) Frame = -2 Query: 164 RSLLSTCSLNHMLQCCNLSNKLINFPLEQLF 72 R+L +TC +N +LQC + + +L ++ L++L+ Sbjct: 18 RNLGNTCFMNSILQCLSNTRELRDYCLQRLY 48
>B915_XENLA (P40745) Maternal B9.15 protein (P30 B9.15)| Length = 233 Score = 27.3 bits (59), Expect = 9.9 Identities = 15/29 (51%), Positives = 21/29 (72%) Frame = +3 Query: 39 MFHTLFVKAYKKQLFQWKINKFIAQVTTL 125 +F T+ VK +K QL + KI KF A++TTL Sbjct: 10 VFLTMLVKKHK-QLSKQKIEKFAAKLTTL 37
>DCN1_CANGA (Q6FJR2) Defective in cullin neddylation protein 1| Length = 273 Score = 27.3 bits (59), Expect = 9.9 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 5/46 (10%) Frame = -2 Query: 155 LSTCSLNHMLQCCNLSNKLINFPLEQLFFVSFNK*C-----MKHLL 33 L T SL H LQC NL N + +Q + +N+ C M+H L Sbjct: 105 LVTISLAHFLQCKNLENPITE---KQFLYFWYNEGCYTLEQMRHYL 147
>OXAA2_LACPL (Q88WR8) Membrane protein oxaA 2 precursor| Length = 307 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 181 MVNQGKHLKHPKHPVSFVKPFMTYVSAEVKAATT 282 M+NQ + + + +S V+P M + A KAATT Sbjct: 78 MINQQRKSTYQQEKMSAVRPQMEKIQARQKAATT 111 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,930,020 Number of Sequences: 219361 Number of extensions: 761020 Number of successful extensions: 1551 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1551 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)