| Clone Name | rbastl55g07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBP8_HUMAN (P40818) Ubiquitin carboxyl-terminal hydrolase 8 (EC ... | 31 | 0.90 | 2 | ENDR_PAEPO (P27871) Probable HTH-type transcriptional regulator ... | 30 | 2.0 | 3 | UBP8_MOUSE (Q80U87) Ubiquitin carboxyl-terminal hydrolase 8 (EC ... | 29 | 3.4 | 4 | STP22_YEAST (P25604) Suppressor protein STP22 of temperature-sen... | 27 | 10.0 |
|---|
>UBP8_HUMAN (P40818) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) (hUBPy) Length = 1118 Score = 30.8 bits (68), Expect = 0.90 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Frame = +3 Query: 45 QYKSSRICIT-HKRNTTISQ---ITQPIRSTNKCTYMMKLLLFS 164 Q+KS+ C+T HK++ T ++ P+ ST+KCT L LFS Sbjct: 929 QFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFS 972
>ENDR_PAEPO (P27871) Probable HTH-type transcriptional regulator endR| Length = 340 Score = 29.6 bits (65), Expect = 2.0 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = +2 Query: 71 YTQKKYHYQSNNTTNKINQQM----YIYDEAAALLHQ 169 + QK+Y+Y S NT KI Q + YI +E A L Q Sbjct: 22 FLQKRYNYMSENTKKKIEQAIEDLSYIPNEVARSLKQ 58
>UBP8_MOUSE (Q80U87) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8) (Deubiquitinating enzyme 8) (mUBPy) Length = 1080 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Frame = +3 Query: 45 QYKSSRICITHKRNTTISQ----ITQPIRSTNKCTYMMKLLLFS 164 Q+KS+ C+T +R + + ++ P+ ST+KCT L LFS Sbjct: 891 QFKSTVQCLTCRRRSRTFEAFMYLSLPLASTSKCTLQDCLRLFS 934
>STP22_YEAST (P25604) Suppressor protein STP22 of temperature-sensitive| alpha-factor receptor and arginine permease (Vacuolar protein sorting-associated protein VPS23) Length = 385 Score = 27.3 bits (59), Expect = 10.0 Identities = 8/18 (44%), Positives = 15/18 (83%) Frame = +3 Query: 228 IKQGREMSASRYLI*WHL 281 +KQGRE++ ++L+ WH+ Sbjct: 360 VKQGRELARQQFLVRWHI 377 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,355,200 Number of Sequences: 219361 Number of extensions: 666180 Number of successful extensions: 1698 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1697 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)