| Clone Name | rbastl55e01 |
|---|---|
| Clone Library Name | barley_pub |
>AROA_SHISO (Q9ZFF7) 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19)| (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) Length = 427 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -3 Query: 385 LGNSDHIEALRVYLLSRSISRLKNEFQTGNGKITVKCIEGYPPIDLQLG 239 LG++D + + R I L + + G KIT E YPP+ LQ G Sbjct: 108 LGSNDIVLTGEPRMKERPIGHLVDALRLGGAKITYLEQENYPPLRLQGG 156
>AROA_SHIDY (O87006) 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19)| (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) Length = 427 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -3 Query: 385 LGNSDHIEALRVYLLSRSISRLKNEFQTGNGKITVKCIEGYPPIDLQLG 239 LG++D + + R I L + + G KIT E YPP+ LQ G Sbjct: 108 LGSNDIVLTGEPRMKERPIGHLVDALRLGRAKITYLEQENYPPLRLQGG 156
>AROA_ECOLI (P0A6D3) 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19)| (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) Length = 427 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -3 Query: 385 LGNSDHIEALRVYLLSRSISRLKNEFQTGNGKITVKCIEGYPPIDLQLG 239 LG++D + + R I L + + G KIT E YPP+ LQ G Sbjct: 108 LGSNDIVLTGEPRMKERPIGHLVDALRLGGAKITYLEQENYPPLRLQGG 156
>AROA_ECOL6 (Q8FJB6) 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19)| (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) Length = 427 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -3 Query: 385 LGNSDHIEALRVYLLSRSISRLKNEFQTGNGKITVKCIEGYPPIDLQLG 239 LG++D + + R I L + + G KIT E YPP+ LQ G Sbjct: 108 LGSNDIVLTGEPRMKERPIGHLVDALRQGGAKITYLEQENYPPLRLQGG 156
>AROA_ECO57 (P0A6D4) 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19)| (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) Length = 427 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -3 Query: 385 LGNSDHIEALRVYLLSRSISRLKNEFQTGNGKITVKCIEGYPPIDLQLG 239 LG++D + + R I L + + G KIT E YPP+ LQ G Sbjct: 108 LGSNDIVLTGEPRMKERPIGHLVDALRLGGAKITYLEQENYPPLRLQGG 156
>RGA4_SCHPO (O74360) Probable Rho-type GTPase-activating protein 4| Length = 933 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/48 (27%), Positives = 27/48 (56%) Frame = -3 Query: 175 STPVLSFSTAIHSNQADSVCTSQKQCIIYLDVLARMEGRWNCQVCIQR 32 STP+ F+ A+ ++QA+ C S + I + + +G+ C C+++ Sbjct: 86 STPICEFN-AVSNSQANHPCCSNCRAFINSNAFGKFKGQHYCLPCLRK 132
>ARE1_YEAST (P25628) Sterol O-acyltransferase 1 (EC 2.3.1.26) (Sterol-ester| synthase 1) Length = 610 Score = 28.5 bits (62), Expect = 4.1 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -2 Query: 347 FVVKVHFQIEERIPDWKWQDY 285 FVV VH+ +++RI +WKW + Sbjct: 245 FVVFVHWLVKKRIINWKWTGF 265
>YIM6_BPPH1 (P10430) Hypothetical immunity region protein 6| Length = 70 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = -2 Query: 347 FVVKVHFQIEERIPDWKWQDYGKVHRRL 264 ++ +F+ E +IP K QDY K+H+++ Sbjct: 26 YMQNANFKREPKIPQEKQQDYDKLHQKI 53
>LOX3_SOYBN (P09186) Seed lipoxygenase-3 (EC 1.13.11.12) (L-3)| Length = 857 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +2 Query: 11 HTVID--CISLNTHLTIPSPFHPCQHI*VNDTLLL*GTNRISLI 136 H V++ I+ N HL++ P + H DT+ + G R+SL+ Sbjct: 523 HAVVEPFIIATNRHLSVVHPIYKLLHPHYRDTMNINGLARLSLV 566 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,219,278 Number of Sequences: 219361 Number of extensions: 1021660 Number of successful extensions: 2313 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2313 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)