| Clone Name | rbastl55c05 |
|---|---|
| Clone Library Name | barley_pub |
>UBE13_WHEAT (P31252) Ubiquitin-activating enzyme E1 3| Length = 1053 Score = 58.2 bits (139), Expect = 8e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 420 HLDIGVACEDEDENDVDIPLVSVYFR 343 HLDIGVACEDEDENDVDIPLVSVYFR Sbjct: 1028 HLDIGVACEDEDENDVDIPLVSVYFR 1053
>UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2| Length = 1051 Score = 52.0 bits (123), Expect = 6e-07 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = -3 Query: 420 HLDIGVACEDEDENDVDIPLVSVYFR 343 HLD+ VACED+D+NDVDIPLVSVYFR Sbjct: 1026 HLDVVVACEDDDDNDVDIPLVSVYFR 1051
>UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1| Length = 1051 Score = 52.0 bits (123), Expect = 6e-07 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = -3 Query: 420 HLDIGVACEDEDENDVDIPLVSVYFR 343 HLD+ VACED+D+NDVDIPLVSVYFR Sbjct: 1026 HLDVVVACEDDDDNDVDIPLVSVYFR 1051
>RL18_BURPS (Q63Q27) 50S ribosomal protein L18| Length = 121 Score = 29.6 bits (65), Expect = 3.0 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -1 Query: 206 QAAALALIDLSYHGYLKMFSPCGTLVL 126 Q A LA+ + H Y ++FSPCGT VL Sbjct: 22 QVARLAVHRTNTHIYAQVFSPCGTKVL 48
>RL18_BURMA (Q62GM1) 50S ribosomal protein L18| Length = 121 Score = 29.6 bits (65), Expect = 3.0 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -1 Query: 206 QAAALALIDLSYHGYLKMFSPCGTLVL 126 Q A LA+ + H Y ++FSPCGT VL Sbjct: 22 QVARLAVHRTNTHIYAQVFSPCGTKVL 48
>EAAT_ONCVO (Q25605) Excitatory amino acid transporter (Sodium-dependent| glutamate/ aspartate transporter) Length = 492 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +2 Query: 98 LNATNEQIAAGPVYHKERTS*GNHDMIDRSARERRLDYIRDSAKL-VFESRPEDDD 262 +N + + AG VYH + HD + + R + + +L V+ S P DD+ Sbjct: 433 INVLGDAMGAGIVYHYSKADLDAHDRLAATTRSHSIAMNDEKRQLAVYNSLPTDDE 488
>EAA1_CAEEL (Q10901) Excitatory amino acid transporter (Sodium-dependent| glutamate/ aspartate transporter) Length = 503 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +2 Query: 98 LNATNEQIAAGPVYHKERTS*GNHDMIDRSARERRLDYIRDSAKL-VFESRPEDDD 262 +N + + AG VYH + HD + + R + + +L V+ S P DD+ Sbjct: 444 INVLGDAMGAGIVYHYSKADLDAHDRLAATTRSHSIAMNDEKRQLAVYNSLPTDDE 499
>CHVA_AGRTU (P0A2V1) Beta-(1-->2)glucan export ATP-binding protein chvA| (Attachment protein) Length = 588 Score = 28.1 bits (61), Expect = 8.8 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = +2 Query: 200 RLDYIRDSAKLVFESRPEDDDARFFIL--LVLEKSRPGDDAE 319 RLD +R +FE+R + +D FF+L V E+ PGD E Sbjct: 288 RLDQMRQFVTQIFEARAKLED--FFVLEDAVKEREEPGDARE 327
>CHVA_AGRT5 (P0A2V0) Beta-(1-->2)glucan export ATP-binding protein chvA| (Attachment protein) Length = 588 Score = 28.1 bits (61), Expect = 8.8 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = +2 Query: 200 RLDYIRDSAKLVFESRPEDDDARFFIL--LVLEKSRPGDDAE 319 RLD +R +FE+R + +D FF+L V E+ PGD E Sbjct: 288 RLDQMRQFVTQIFEARAKLED--FFVLEDAVKEREEPGDARE 327 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,307,059 Number of Sequences: 219361 Number of extensions: 1003305 Number of successful extensions: 1967 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1967 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)