| Clone Name | rbastl55c02 |
|---|---|
| Clone Library Name | barley_pub |
>SC24C_ARATH (Q9M291) Protein transport protein Sec24-like CEF| Length = 1097 Score = 102 bits (255), Expect = 2e-22 Identities = 48/78 (61%), Positives = 64/78 (82%), Gaps = 1/78 (1%) Frame = -2 Query: 411 PNLLALEQFDNALSRKVNEVVNEIRRQRCSYLRLRLCRKGDPSGD-FFRSLLVEDKAPGG 235 P+ L+++DN LS+K N+VVNEIRRQR SYLR++LC+KGDP+G+ F+S +VED+ GG Sbjct: 1019 PSQYVLQKYDNQLSKKFNDVVNEIRRQRSSYLRIKLCKKGDPAGNMLFQSYMVEDRGSGG 1078 Query: 234 LSYVEFLVHVHRQIQSKM 181 SYV+FLV VHRQIQ K+ Sbjct: 1079 ASYVDFLVSVHRQIQHKL 1096
>SC24C_HUMAN (P53992) Protein transport protein Sec24C (SEC24-related protein C)| Length = 1094 Score = 61.2 bits (147), Expect = 6e-10 Identities = 30/77 (38%), Positives = 49/77 (63%), Gaps = 1/77 (1%) Frame = -2 Query: 405 LLALEQFDNALSRKVNEVVNEIRRQRCSYLRLRLCRKGDPSGDFFRSLLVEDKA-PGGLS 229 L L DN LS+KV +++ +R QR Y++L + ++ D F+ LVEDK+ GG S Sbjct: 1018 LSVLPVLDNPLSKKVRGLIDSLRAQRSRYMKLTVVKQEDKMEMLFKHFLVEDKSLSGGAS 1077 Query: 228 YVEFLVHVHRQIQSKMT 178 YV+FL H+H++I+ ++ Sbjct: 1078 YVDFLCHMHKEIRQLLS 1094
>SC24B_ARATH (Q9M081) Putative protein transport protein Sec24-like At4g32640| Length = 1069 Score = 53.1 bits (126), Expect = 2e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -2 Query: 411 PNLLALEQFDNALSRKVNEVVNEIRRQRCSYLR 313 PN L+Q+DN LS+K N+ VNEIRRQRCSYLR Sbjct: 1003 PNQFVLQQYDNQLSKKFNDAVNEIRRQRCSYLR 1035
>SC24D_HUMAN (O94855) Protein transport protein Sec24D (SEC24-related protein D)| Length = 1032 Score = 41.2 bits (95), Expect = 6e-04 Identities = 23/73 (31%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Frame = -2 Query: 408 NLLALEQFDNALSRKVNEVVNEIRRQRCSYLRLRLCRKGDPSGDFFRSLLVEDKAP-GGL 232 ++ L + N S+++ ++ I+++R ++L + ++ + FR LVEDK GG Sbjct: 955 DMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGS 1014 Query: 231 SYVEFLVHVHRQI 193 SYV+FL VH++I Sbjct: 1015 SYVDFLCCVHKEI 1027
>SC24A_ARATH (Q9SFU0) Protein transport protein Sec24-like At3g07100| Length = 1038 Score = 40.0 bits (92), Expect = 0.001 Identities = 22/74 (29%), Positives = 44/74 (59%), Gaps = 3/74 (4%) Frame = -2 Query: 402 LALEQFDNALSRKVNEVVNEIRRQRCSYLRLR-LCRKGDPSGDFFRSL--LVEDKAPGGL 232 + ++ +N +S+K+ +V ++R SY + L R+G+ + F L L+ED+ G Sbjct: 963 VTFQEQENGMSKKLMRLVKKLRESDPSYHPMCFLVRQGEQPREGFLLLRNLIEDQMGGSS 1022 Query: 231 SYVEFLVHVHRQIQ 190 YV++++ +HRQ+Q Sbjct: 1023 GYVDWILQLHRQVQ 1036
>SC24A_HUMAN (O95486) Protein transport protein Sec24A (SEC24-related protein A)| (Fragment) Length = 1078 Score = 39.7 bits (91), Expect = 0.002 Identities = 20/68 (29%), Positives = 35/68 (51%) Frame = -2 Query: 396 LEQFDNALSRKVNEVVNEIRRQRCSYLRLRLCRKGDPSGDFFRSLLVEDKAPGGLSYVEF 217 L + D S ++ ++ +R QR + L + R P F ++ED+ LSY EF Sbjct: 1009 LPELDTPESARIIAFISWLREQRPFFPILYVIRDESPMKANFLQNMIEDRTESALSYYEF 1068 Query: 216 LVHVHRQI 193 L+H+ +Q+ Sbjct: 1069 LLHIQQQV 1076
>SC24A_MOUSE (Q3U2P1) Protein transport protein Sec24A (SEC24-related protein A)| Length = 1090 Score = 38.9 bits (89), Expect = 0.003 Identities = 21/68 (30%), Positives = 35/68 (51%) Frame = -2 Query: 396 LEQFDNALSRKVNEVVNEIRRQRCSYLRLRLCRKGDPSGDFFRSLLVEDKAPGGLSYVEF 217 L + D S ++ ++ +R QR + L + R+ F LVED+ LSY EF Sbjct: 1021 LPELDTPESARIAAFISWLREQRPFFPVLYVIREESLMKAAFLQSLVEDRTESALSYYEF 1080 Query: 216 LVHVHRQI 193 L+H+ +Q+ Sbjct: 1081 LLHIQQQV 1088
>SC24B_HUMAN (O95487) Protein transport protein Sec24B (SEC24-related protein B)| Length = 1268 Score = 36.2 bits (82), Expect = 0.019 Identities = 20/68 (29%), Positives = 31/68 (45%) Frame = -2 Query: 396 LEQFDNALSRKVNEVVNEIRRQRCSYLRLRLCRKGDPSGDFFRSLLVEDKAPGGLSYVEF 217 L + D S + + +R R L + + P+ F L+ED+ SY EF Sbjct: 1199 LPELDTLSSERARSFITWLRDSRPLSPILHIVKDESPAKAEFFQHLIEDRTEAAFSYYEF 1258 Query: 216 LVHVHRQI 193 L+HV +QI Sbjct: 1259 LLHVQQQI 1266
>YNB3_SCHPO (Q9USS7) Hypothetical protein C4.03c in chromosome II| Length = 891 Score = 35.4 bits (80), Expect = 0.032 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 3/76 (3%) Frame = -2 Query: 402 LALEQFDNALSRKVNEVVNEIRRQRCSY-LRLRLCRKG--DPSGDFFRSLLVEDKAPGGL 232 L L D LS +V +++ +R Q S L ++ R+G G+ F S LVED G Sbjct: 814 LELPTLDTVLSVQVRNLLSSLRMQFPSMALHPQIVRQGLDGSEGEIF-STLVEDNTREGF 872 Query: 231 SYVEFLVHVHRQIQSK 184 Y++FL +H + ++ Sbjct: 873 GYLDFLTKIHESLHTQ 888
>SODC_PHOLE (P00446) Superoxide dismutase [Cu-Zn] precursor (EC 1.15.1.1)| Length = 173 Score = 31.6 bits (70), Expect = 0.47 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +3 Query: 237 HQVLCPPPTANGRNLQTGRPFGTVSVSSKSISVALFHSRLHSLSWTMH 380 HQ L T +LQTG+P GT+ +S V +F L L+ MH Sbjct: 18 HQALAQDLTVKMTDLQTGKPVGTIELSQNKYGV-VFTPELADLTPGMH 64
>YCF1_ADICA (Q85FG7) Hypothetical 199.0 kDa protein ycf1| Length = 1691 Score = 30.8 bits (68), Expect = 0.80 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 5/65 (7%) Frame = +1 Query: 130 GIDNLYQPKYHTNEASGHLALDLPVNMYEEL---HIGKATRCFVLHQQRTEE--ISRRVA 294 G+ NLYQPK + + H L + E+ H+ T CF +T+E +VA Sbjct: 1170 GVSNLYQPKMYEKQTPVHYNLIATKFLSPEIRNNHVNDLTMCFDTETGKTDEEFFDEKVA 1229 Query: 295 LSAQS 309 S ++ Sbjct: 1230 RSIEN 1234
>SYNE1_HUMAN (Q8NF91) Nesprin-1 (Nuclear envelope spectrin repeat protein 1)| (Synaptic nuclear envelope protein 1) (Syne-1) (Myocyte nuclear envelope protein 1) (Myne-1) (Enaptin) Length = 8797 Score = 30.4 bits (67), Expect = 1.0 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 4/57 (7%) Frame = +1 Query: 178 GHLALDLPVNMYEELHI--GKATRCFVLHQQRTEEISRR-VALSAQSQ-SQVRASLS 336 GHLA + E+LH+ GKA CF L ++ ++ + RR +ALS ++ Q ASLS Sbjct: 1825 GHLAKLGSLGRAEDLHLLQGKAEDCFQLFEEASQVVERRQLALSHLAEFLQSHASLS 1881
>RARA_FUGRU (Q9W5Z3) Retinoic acid receptor alpha (RAR-alpha)| Length = 447 Score = 28.9 bits (63), Expect = 3.0 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 369 RKVNEVVNEIRRQRCSYLRLRLC 301 R+ N ++N++ R RC Y RL+ C Sbjct: 118 REKNCIINKVTRNRCQYCRLQKC 140
>NU5C_ORYSA (P12129) NAD(P)H-quinone oxidoreductase chain 5, chloroplast (EC| 1.6.5.-) (NAD(P)H dehydrogenase, chain 5) (NADH-plastoquinone oxidoreductase chain 5) Length = 734 Score = 28.9 bits (63), Expect = 3.0 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 62 LSTSTNSFQKEKRSI*SLYTHMRESIISTNQNITPMKLQVILLWICL 202 L+ S N FQ+ S + Y + +I S + I + + + +LWICL Sbjct: 576 LTPSINFFQESSNSSINSYEFITNAISSVSLAIFGLFIGIYVLWICL 622
>SYGM2_ARATH (Q8L785) Glycyl-tRNA synthetase 2, chloroplast/mitochondrial| precursor (EC 6.1.1.14) (Glycine--tRNA ligase 2) (GlyRS 2) Length = 1067 Score = 28.9 bits (63), Expect = 3.0 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 76 KLFSERKTVHLIFVYPHAGIDNLYQP-KYHTNEASGHLALDLPVNMYEEL 222 +LF E + + HA +D L + Y EA LAL LP+ Y++L Sbjct: 257 ELFLENEKEMSSYYLEHASVDRLQKHFDYFDEEARSLLALGLPIPAYDQL 306
>STE20_YEAST (Q03497) Serine/threonine-protein kinase STE20 (EC 2.7.11.1)| Length = 939 Score = 28.5 bits (62), Expect = 4.0 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Frame = -2 Query: 378 ALSRKVNEVVNEIRRQRCSYLRLRL---CRKGDPSGDFFRSLLVEDKAPGGL 232 +LS+++NE E R +R L +L C GDPS + + + A GG+ Sbjct: 583 SLSKELNEKKREERERRKKQLYAKLNEICSDGDPSTKYANLVKIGQGASGGV 634
>RARB_NOTVI (P18515) Retinoic acid receptor beta (RAR-beta) (Fragment)| Length = 158 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 369 RKVNEVVNEIRRQRCSYLRLRLC 301 R N V+N++ R RC Y RL+ C Sbjct: 72 RDKNCVINKVTRNRCQYCRLQRC 94
>RARB_MOUSE (P22605) Retinoic acid receptor beta (RAR-beta)| Length = 482 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 369 RKVNEVVNEIRRQRCSYLRLRLC 301 R N V+N++ R RC Y RL+ C Sbjct: 153 RDKNCVINKVTRNRCQYCRLQKC 175
>RARB_HUMAN (P10826) Retinoic acid receptor beta (RAR-beta) (RAR-epsilon)| (HBV-activated protein) Length = 455 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 369 RKVNEVVNEIRRQRCSYLRLRLC 301 R N V+N++ R RC Y RL+ C Sbjct: 126 RDKNCVINKVTRNRCQYCRLQKC 148
>RARB_COTJA (Q9W6B3) Retinoic acid receptor beta (RAR-beta)| Length = 455 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 369 RKVNEVVNEIRRQRCSYLRLRLC 301 R N V+N++ R RC Y RL+ C Sbjct: 126 RDKNCVINKVTRNRCQYCRLQKC 148
>RARB_CHICK (P22448) Retinoic acid receptor beta (RAR-beta)| Length = 455 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 369 RKVNEVVNEIRRQRCSYLRLRLC 301 R N V+N++ R RC Y RL+ C Sbjct: 126 RDKNCVINKVTRNRCQYCRLQKC 148
>RARG1_MOUSE (P18911) Retinoic acid receptor gamma-A (RAR-gamma-A)| Length = 458 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 369 RKVNEVVNEIRRQRCSYLRLRLC 301 R N ++N++ R RC Y RL+ C Sbjct: 128 RDKNCIINKVTRNRCQYCRLQKC 150
>RARA_XENLA (P51126) Retinoic acid receptor alpha (RAR-alpha)| Length = 458 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 369 RKVNEVVNEIRRQRCSYLRLRLC 301 R N ++N++ R RC Y RL+ C Sbjct: 126 RDKNCIINKVTRNRCQYCRLQKC 148
>RARG2_MOUSE (P20787) Retinoic acid receptor gamma-B (RAR-gamma-B)| Length = 447 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 369 RKVNEVVNEIRRQRCSYLRLRLC 301 R N ++N++ R RC Y RL+ C Sbjct: 117 RDKNCIINKVTRNRCQYCRLQKC 139
>RARG2_HUMAN (P22932) Retinoic acid receptor gamma-2 (RAR-gamma-2)| Length = 443 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 369 RKVNEVVNEIRRQRCSYLRLRLC 301 R N ++N++ R RC Y RL+ C Sbjct: 117 RDKNCIINKVTRNRCQYCRLQKC 139
>RARA_CHICK (Q90966) Retinoic acid receptor alpha (RAR-alpha)| Length = 460 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 369 RKVNEVVNEIRRQRCSYLRLRLC 301 R N ++N++ R RC Y RL+ C Sbjct: 126 RDKNCIINKVTRNRCQYCRLQKC 148
>RARG1_HUMAN (P13631) Retinoic acid receptor gamma-1 (RAR-gamma-1)| Length = 454 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 369 RKVNEVVNEIRRQRCSYLRLRLC 301 R N ++N++ R RC Y RL+ C Sbjct: 128 RDKNCIINKVTRNRCQYCRLQKC 150
>RARA_MOUSE (P11416) Retinoic acid receptor alpha (RAR-alpha)| Length = 462 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 369 RKVNEVVNEIRRQRCSYLRLRLC 301 R N ++N++ R RC Y RL+ C Sbjct: 126 RDKNCIINKVTRNRCQYCRLQKC 148
>RARA_HUMAN (P10276) Retinoic acid receptor alpha (RAR-alpha)| Length = 462 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 369 RKVNEVVNEIRRQRCSYLRLRLC 301 R N ++N++ R RC Y RL+ C Sbjct: 126 RDKNCIINKVTRNRCQYCRLQKC 148
>RARA_CANFA (Q5FBR4) Retinoic acid receptor alpha (RAR-alpha)| Length = 462 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 369 RKVNEVVNEIRRQRCSYLRLRLC 301 R N ++N++ R RC Y RL+ C Sbjct: 126 RDKNCIINKVTRNRCQYCRLQKC 148
>NU2C_MARPO (P06257) NAD(P)H-quinone oxidoreductase chain 2, chloroplast (EC| 1.6.5.-) (NAD(P)H dehydrogenase, chain 2) (NADH-plastoquinone oxidoreductase chain 2) Length = 501 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -3 Query: 107 KWTVFLSEKSLYSYLITLFVLRFSYKDSIVVSF 9 K T++L SL S LI++ +L F YK ++SF Sbjct: 38 KDTIWLYFISLTSLLISIIILLFQYKTDPIISF 70
>Y1076_METJA (Q58476) Hypothetical ATP-binding protein MJ1076| Length = 337 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 317 K*EHLCRLISFTTSFTFLDNALSNCS 394 K EHLC +I T+ F+DN N S Sbjct: 163 KMEHLCHVICLTSDTLFIDNVYRNSS 188
>PIFA_ECOLI (P96329) Phage T7 exclusion protein| Length = 741 Score = 27.7 bits (60), Expect = 6.8 Identities = 18/67 (26%), Positives = 32/67 (47%) Frame = +1 Query: 160 HTNEASGHLALDLPVNMYEELHIGKATRCFVLHQQRTEEISRRVALSAQSQSQVRASLSP 339 HT+E S ++ P E+ I + R + H Q +E +R + L + + SP Sbjct: 531 HTDEVSTRFSIRNPWFSLREMAINEVVRHLLKHMQDIDE-TRTITL---MEKLIVTGASP 586 Query: 340 YFIHDFI 360 ++I DF+ Sbjct: 587 FWIADFM 593
>DLTA_STAXY (Q9X2N4) D-alanine--poly(phosphoribitol) ligase subunit 1 (EC| 6.1.1.13) (D-alanine-activating enzyme) (DAE) (D-alanine-D-alanyl carrier protein ligase) (DCL) Length = 487 Score = 27.7 bits (60), Expect = 6.8 Identities = 17/54 (31%), Positives = 23/54 (42%) Frame = +1 Query: 118 YPHAGIDNLYQPKYHTNEASGHLALDLPVNMYEELHIGKATRCFVLHQQRTEEI 279 +P A I N Y P T + L + +N Y L +GKA L EE+ Sbjct: 277 FPSAYIYNTYGPTEATVAVTSILITEAVINQYNPLPVGKARPGTQLSLAENEEL 330
>KTNB1_CHICK (Q5ZIU8) Katanin p80 WD40-containing subunit B1 (Katanin p80| subunit B1) (p80 katanin) Length = 657 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 228 RKGHQVLCPPPTANGRNLQTGRPFGTVSVSSKSISVAL 341 RKGH+ +C T+ +NL T R + S S+ A+ Sbjct: 494 RKGHKTVCMVLTSRHKNLDTVRAVWSTSDMKNSVDAAV 531
>DHSL_CAUCR (Q9AB72) Deoxyhypusine synthase-like protein (EC 2.5.-.-)| Length = 367 Score = 27.3 bits (59), Expect = 8.8 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -2 Query: 384 DNALSRKVNEVVNEIRRQRCSYLRLRLCRKGDPSGDFFRSLLVE 253 DN + R + ++E Q C + L +C K +P G R + E Sbjct: 143 DNYIDRIYDTYIDEEELQACDHTILEICNKLEPRGYSSREFIWE 186
>RS16_LEPIN (Q8F3L1) 30S ribosomal protein S16| Length = 88 Score = 27.3 bits (59), Expect = 8.8 Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -2 Query: 318 LRLRLCRKGDPSGDFFRSLLVEDKAPGGLSYVEFLVHVH-RQIQSKMT*SFIGVIFWL 148 ++LRL R G +R + + ++P +V+ + H H QI+ + T + ++ WL Sbjct: 2 VKLRLQRTGTKHDPHYRIVAADSRSPRDGKFVDIVGHYHPAQIKEQTTFNKEKILTWL 59
>RS16_LEPIC (P62232) 30S ribosomal protein S16| Length = 88 Score = 27.3 bits (59), Expect = 8.8 Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -2 Query: 318 LRLRLCRKGDPSGDFFRSLLVEDKAPGGLSYVEFLVHVH-RQIQSKMT*SFIGVIFWL 148 ++LRL R G +R + + ++P +V+ + H H QI+ + T + ++ WL Sbjct: 2 VKLRLQRTGTKHDPHYRIVAADSRSPRDGKFVDIVGHYHPAQIKEQTTFNKEKILTWL 59
>LON_MYCPN (P78025) ATP-dependent protease La (EC 3.4.21.53)| Length = 795 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -2 Query: 393 EQFDNALSRKVNEVVNEIRRQRCSYLRLRL 304 ++ DN ++RKVNE ++ R+QR YLR +L Sbjct: 230 DKIDNRITRKVNEQLS--RQQRDFYLREKL 257
>K0323_MOUSE (Q80U38) Protein KIAA0323| Length = 671 Score = 27.3 bits (59), Expect = 8.8 Identities = 21/61 (34%), Positives = 29/61 (47%) Frame = +1 Query: 175 SGHLALDLPVNMYEELHIGKATRCFVLHQQRTEEISRRVALSAQSQSQVRASLSPYFIHD 354 S HL LP + L I T FV+ Q R EE+ +R++ Q QS A + + D Sbjct: 108 SAHLVPLLPGS----LMISGLTEAFVMAQSRVEELVQRLSWDLQLQSCPGAPDNGGVLRD 163 Query: 355 F 357 F Sbjct: 164 F 164
>BRO1_NEUCR (Q7SAN9) Vacuolar protein-sorting protein bro-1 (BRO| domain-containing protein 1) Length = 1012 Score = 27.3 bits (59), Expect = 8.8 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +1 Query: 223 HIGKATRCFVLHQQRTEEISRRVALSAQSQSQVRASLSPYFIHDFIHFP 369 +I C HQ RTEE + +A Q A + Y +F+H P Sbjct: 117 NISAVLSCHAAHQLRTEEAGLK---TAYHSFQASAGMFTYINENFLHAP 162 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,947,997 Number of Sequences: 219361 Number of extensions: 1392799 Number of successful extensions: 3904 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 3846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3902 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)