| Clone Name | rbastl55a03 |
|---|---|
| Clone Library Name | barley_pub |
>MEC10_CAEEL (P34886) Degenerin mec-10 (Mechanosensory abnormality protein 10)| Length = 724 Score = 31.2 bits (69), Expect = 0.63 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 3/73 (4%) Frame = -1 Query: 278 EKKKNRT*SCHLELRWSDPGILKSPEKPLQSLSSRRGKREAEVAKQAIICRISLTNLSKT 99 +++ N CH + +W++ E L S +++G + +E+ K+ IC SK Sbjct: 276 DRQTNDAWPCHRKEQWTNTTCQTCDEHYLCSKKAKKGTKRSELKKEPCICE------SKG 329 Query: 98 LW---HHHASILL 69 L+ H HA+++L Sbjct: 330 LFCIKHEHAAMVL 342
>SYA_LACPL (Q88V10) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 880 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +2 Query: 8 RYIKIIVAIPIGQYSNEANGTTKLRHGGAIGFWRGLS 118 +Y KI+ + IG YS E +G T +++ +G ++ +S Sbjct: 652 KYGKIVRVVSIGDYSIEFDGGTHVKNSSELGLFKIVS 688
>AL4A1_MOUSE (Q8CHT0) Delta-1-pyrroline-5-carboxylate dehydrogenase,| mitochondrial precursor (EC 1.5.1.12) (P5C dehydrogenase) (Aldehyde dehydrogenase 4A1) Length = 562 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 290 GGRSEKKKNRT*SCHLELRWSDPGILKSPEKPL 192 G R+ ++ H LRW+ P ++K KPL Sbjct: 521 GARASGTNDKPGGPHYILRWTSPQVIKETHKPL 553
>CO4_RAT (P08649) Complement C4 precursor [Contains: Complement C4 beta chain;| Complement C4 alpha chain; C4a anaphylatoxin; Complement C4 gamma chain] Length = 1737 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 Query: 227 DPGILKSPEKPLQSLSSRRGKREAEVAKQA 138 DP + P PLQ RR +R E K A Sbjct: 1423 DPSVHSQPVTPLQLFEGRRSRRRREAPKAA 1452
>AL4A1_HUMAN (P30038) Delta-1-pyrroline-5-carboxylate dehydrogenase,| mitochondrial precursor (EC 1.5.1.12) (P5C dehydrogenase) (Aldehyde dehydrogenase 4A1) Length = 563 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 290 GGRSEKKKNRT*SCHLELRWSDPGILKSPEKPL 192 G R+ ++ H LRW+ P ++K KPL Sbjct: 522 GARASGTNDKPGGPHYILRWTSPQVIKETHKPL 554 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,114,357 Number of Sequences: 219361 Number of extensions: 930910 Number of successful extensions: 3222 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3222 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)