| Clone Name | rbastl54h09 |
|---|---|
| Clone Library Name | barley_pub |
>SIA4B_RAT (Q11205) CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,| 3-sialyltransferase (EC 2.4.99.-) (Beta-galactoside alpha-2,3-sialyltransferase) (Alpha 2,3-ST) (Gal-NAc6S) (Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase) (ST3GALA.2) (SIAT4-B) (ST3 Length = 350 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 291 GTAEWYNSHMDSKYALISEIWT 356 GT+EW++SH DS IS +WT Sbjct: 80 GTSEWFDSHFDSN---ISPVWT 98
>TAB3_XENLA (Q7ZXH3) Mitogen-activated protein kinase kinase kinase| 7-interacting protein 3 homolog Length = 692 Score = 29.6 bits (65), Expect = 1.8 Identities = 8/25 (32%), Positives = 18/25 (72%) Frame = +1 Query: 121 IPECFLQDHSDTSVCYKRIQEQNCK 195 + +C LQ++S+ CY+ + +++CK Sbjct: 28 VSQCMLQNNSNLDACYRALTQESCK 52
>PYR5_FREDI (P11401) Phycobilisome 37.5 kDa linker polypeptide,| phycocyanin-associated, rod (L-37.5/R) Length = 268 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = +2 Query: 152 IHQYVTKEYRNKTAKLLHDHQQHNLCGYRY*PHIYALQLSP*RRTVGYSRMVQ 310 ++ Y K Y + + + G R PH + P ++TVG++RM Q Sbjct: 114 VNLYTEKGYEAEINSYIDSAEYQESFGERIVPHYRGFETQPGQKTVGFNRMFQ 166
>PYRH_CHLTR (O84685) Uridylate kinase (EC 2.7.4.-) (UK) (Uridine monophosphate| kinase) (UMP kinase) Length = 245 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = -3 Query: 296 CTLPFVVMVKAARHIYGVNNDNHRDCA---ADDHATVLQFCS 180 C L V++KA H+ GV + + R+CA DH + F S Sbjct: 153 CELKVDVLLKATMHVDGVYDQDPRECADAVRYDHISYRDFLS 194
>NU5M_FELCA (P48921) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 606 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 7/40 (17%) Frame = -3 Query: 101 IPRMLLQHFIIMTALCVHLWGF*I-------LKSLQFMFP 3 IP+M + +++ +TAL V + GF + K+L+FM+P Sbjct: 477 IPQMTMPYYLKLTALAVTIAGFILALELNLAAKNLKFMYP 516
>COX2_BRECS (P43370) Cytochrome c oxidase subunit 2 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide II) Length = 247 Score = 27.3 bits (59), Expect = 9.0 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 1/91 (1%) Frame = -1 Query: 394 MVTFLSNSRF*LQVQISEINAYLESMWLLYHSAV-PYRSSSW*KLQGIYMGLITITTEIV 218 M+ +N F L + + + L +M Y+ +V PY+ + QG +M ++ T V Sbjct: 32 MLELHNNVVFYLCMMLGFVTFMLYNMLTTYNKSVMPYKYLN----QGQFMEMMWTTLPAV 87 Query: 217 LLMIMQQFCSFVPVFFCNILMYQNGPARNIR 125 +L+++ F SF+ ++ C+ +M PA I+ Sbjct: 88 MLLMIA-FPSFILLYMCDEVM---APAMTIK 114
>NU5M_CANFA (Q9ZZ57) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 606 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 101 IPRMLLQHFIIMTALCVHLWGF 36 IP+M + H++ MTAL V + GF Sbjct: 477 IPQMTMPHYLKMTALAVTILGF 498 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,649,919 Number of Sequences: 219361 Number of extensions: 1138268 Number of successful extensions: 2488 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2487 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)