| Clone Name | rbastl54h03 |
|---|---|
| Clone Library Name | barley_pub |
>MYO1B_RAT (Q05096) Myosin Ib (Myosin I alpha) (MMI-alpha) (MMIa) (Myosin| heavy chain myr 1) Length = 1136 Score = 28.9 bits (63), Expect = 3.2 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 7/77 (9%) Frame = -3 Query: 258 KRLCAMTA**MFWKGSVLTSSNI*FSGVP------SH*RYRLFPQNPESLIELLILRKEE 97 K LC T WKG + + F+ + S R ++F +NP +L +L LRK+ Sbjct: 646 KMLCKQTW--PHWKGPARSGVEVLFNELEIPVEEYSFGRSKIFIRNPRTLFQLEDLRKQR 703 Query: 96 SIFPQTLSSERYK-WRC 49 TL + Y+ W+C Sbjct: 704 LEDLATLIQKIYRGWKC 720
>CP27A_RAT (P17178) Cytochrome P450 27, mitochondrial precursor (EC| 1.14.13.15) (Cytochrome P-450C27/25) (Sterol 26-hydroxylase) (Sterol 27-hydroxylase) (Vitamin D(3) 25-hydroxylase) (5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 27-hydroxylase) Length = 533 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/39 (28%), Positives = 24/39 (61%) Frame = -3 Query: 153 LFPQNPESLIELLILRKEESIFPQTLSSERYKWRCVEED 37 LFP+N + ++ ++ ++ S+FP+ S + ++W ED Sbjct: 420 LFPKNTQFVLCHYVVSRDPSVFPEPESFQPHRWLRKRED 458
>MYO1B_MOUSE (P46735) Myosin Ib (Myosin I alpha) (MMI-alpha) (MMIa) (MIH-L)| Length = 1107 Score = 28.9 bits (63), Expect = 3.2 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 7/77 (9%) Frame = -3 Query: 258 KRLCAMTA**MFWKGSVLTSSNI*FSGVP------SH*RYRLFPQNPESLIELLILRKEE 97 K LC T WKG + + F+ + S R ++F +NP +L +L LRK+ Sbjct: 646 KMLCKQTW--PHWKGPARSGVEVLFNELEIPVEEHSFGRSKIFIRNPRTLFQLEDLRKQR 703 Query: 96 SIFPQTLSSERYK-WRC 49 TL + Y+ W+C Sbjct: 704 LEDLATLIQKIYRGWKC 720
>MYO1B_HUMAN (O43795) Myosin Ib (Myosin I alpha) (MMI-alpha) (MMIa) (MYH-1c)| Length = 1136 Score = 28.5 bits (62), Expect = 4.2 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 7/77 (9%) Frame = -3 Query: 258 KRLCAMTA**MFWKGSVLTSSNI*FSGVP------SH*RYRLFPQNPESLIELLILRKEE 97 K LC T WKG + + F+ + S R ++F +NP +L +L LRK+ Sbjct: 646 KMLCKQTW--PHWKGPARSGVEVLFNELEIPVEEYSFGRSKIFIRNPRTLFKLEDLRKQR 703 Query: 96 SIFPQTLSSERYK-WRC 49 TL + Y+ W+C Sbjct: 704 LEDLATLIQKIYRGWKC 720
>CP27A_MOUSE (Q9DBG1) Cytochrome P450 27, mitochondrial precursor (EC| 1.14.13.15) (Cytochrome P-450C27/25) (Sterol 26-hydroxylase) (Sterol 27-hydroxylase) (Vitamin D(3) 25-hydroxylase) (5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 27-hydroxylase) Length = 533 Score = 27.3 bits (59), Expect = 9.3 Identities = 9/33 (27%), Positives = 22/33 (66%) Frame = -3 Query: 153 LFPQNPESLIELLILRKEESIFPQTLSSERYKW 55 LFP+N + ++ ++ ++ S+FP+ S + ++W Sbjct: 420 LFPKNTQFVLCHYVVSRDPSVFPEPNSFQPHRW 452 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,500,100 Number of Sequences: 219361 Number of extensions: 840678 Number of successful extensions: 1588 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1588 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)