| Clone Name | rbastl54f09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | I11RA_RAT (Q99MF4) Interleukin-11 receptor alpha chain precursor... | 28 | 7.5 | 2 | FGR_HUMAN (P09769) Proto-oncogene tyrosine-protein kinase FGR (E... | 28 | 7.5 | 3 | CJ095_HUMAN (Q9H7T3) Protein C10orf95 | 27 | 9.8 | 4 | TRI14_MOUSE (Q8BVW3) Tripartite motif protein 14 (PU.1-binding p... | 27 | 9.8 |
|---|
>I11RA_RAT (Q99MF4) Interleukin-11 receptor alpha chain precursor| (IL-11R-alpha) (IL-11RA) Length = 431 Score = 27.7 bits (60), Expect = 7.5 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +2 Query: 185 RPTSRPGSFTSPPLGVHDLREDRARRQP--VRVDARDALVAHAYGS 316 RP P T P+G+ +L D P VRV ARD L A + + Sbjct: 261 RPAQHPAWSTVEPIGLEELITDAVAGLPHAVRVSARDFLDAGTWSA 306
>FGR_HUMAN (P09769) Proto-oncogene tyrosine-protein kinase FGR (EC 2.7.10.2)| (P55-FGR) (C-FGR) Length = 529 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 278 RLGRADAERGLLADHEPQGA 219 ++GR DAER LL+ PQGA Sbjct: 148 KIGRKDAERQLLSPGNPQGA 167
>CJ095_HUMAN (Q9H7T3) Protein C10orf95| Length = 257 Score = 27.3 bits (59), Expect = 9.8 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = +2 Query: 185 RPTSRPGSFTSPPLGVHDLREDRARRQPVRVDARDALVAHAYGSCRG 325 RPT RP + +PP D R R RR P R R SC G Sbjct: 125 RPTPRPCAGPAPPPASRDCRCRRPRRWP-RAGRRGRRAGACKPSCAG 170
>TRI14_MOUSE (Q8BVW3) Tripartite motif protein 14 (PU.1-binding protein)| Length = 440 Score = 27.3 bits (59), Expect = 9.8 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 323 HDNFHKHGRPKRREHRLG-RADAERGLLADHEPQGAV 216 HD RP+R HRLG D E G+LA ++ G + Sbjct: 373 HDGQRSRLRPRRDPHRLGVFLDYEAGILAFYDVAGGM 409 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,128,446 Number of Sequences: 219361 Number of extensions: 697430 Number of successful extensions: 1525 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1523 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)