| Clone Name | rbastl54e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZNF26_HUMAN (P17031) Zinc finger protein 26 (Zinc finger protein... | 28 | 5.0 | 2 | ASPG2_ARATH (Q8GXG1) Probable L-asparaginase 2 precursor (EC 3.5... | 28 | 5.0 |
|---|
>ZNF26_HUMAN (P17031) Zinc finger protein 26 (Zinc finger protein KOX20)| Length = 199 Score = 28.5 bits (62), Expect = 5.0 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +2 Query: 32 KRSDCTDLYQIRMKITDHTRILASQTMTKMSACPASSCW 148 K S+C + + +++H R+ + K S C S CW Sbjct: 149 KCSECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCW 187
>ASPG2_ARATH (Q8GXG1) Probable L-asparaginase 2 precursor (EC 3.5.1.1)| (L-asparagine amidohydrolase 2) [Contains: L-asparaginase 2 alpha subunit; L-asparaginase 2 beta subunit] Length = 325 Score = 28.5 bits (62), Expect = 5.0 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 76 YRPYTYTCITNDDKNECVSGEFLLGIVTSQM-YVLSSPIILAG 201 Y P T C+ D K C +G G++ M + SP+I AG Sbjct: 191 YAPETVGCVVVDGKGHCAAGTSTGGLMNKMMGRIGDSPLIGAG 233 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,829,278 Number of Sequences: 219361 Number of extensions: 448680 Number of successful extensions: 1161 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1161 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)