| Clone Name | rbastl54e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ABDA_DROME (P29555) Homeobox protein abdominal-A | 28 | 4.2 | 2 | VE4_HPV54 (Q81022) Probable protein E4 | 28 | 7.2 | 3 | RL24_NANEQ (P60663) 50S ribosomal protein L24P | 27 | 9.4 | 4 | RES2_SCHPO (P41412) Cell division cycle-related protein res2/pct1 | 27 | 9.4 |
|---|
>ABDA_DROME (P29555) Homeobox protein abdominal-A| Length = 590 Score = 28.5 bits (62), Expect = 4.2 Identities = 22/73 (30%), Positives = 35/73 (47%) Frame = -1 Query: 300 SDEAGQSTSTLSHWAFGCFEYTHEGMNLSGEWGSFASISDSLQADVPATAFYSELAA**H 121 + +AG S+ + S A G H +N + + AS S S + V A A + AA Sbjct: 195 NSQAGDSSCSPSPSASGSSSL-HRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSS 253 Query: 120 FAVSSPKCPPFIS 82 FA+ + K P++S Sbjct: 254 FAIPTSKMYPYVS 266
>VE4_HPV54 (Q81022) Probable protein E4| Length = 134 Score = 27.7 bits (60), Expect = 7.2 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -2 Query: 281 PRQHCRIGLLAVLNTP 234 P++HC+ LLA+LNTP Sbjct: 50 PKRHCQYPLLALLNTP 65
>RL24_NANEQ (P60663) 50S ribosomal protein L24P| Length = 140 Score = 27.3 bits (59), Expect = 9.4 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 206 HSPDKFIPSWVYSKQPKAQ 262 ++P + PSWV SKQP+ Q Sbjct: 7 YNPSDWSPSWVRSKQPRKQ 25
>RES2_SCHPO (P41412) Cell division cycle-related protein res2/pct1| Length = 657 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +2 Query: 206 HSPDKFIPSWVYSKQPKAQCDNVDVDCPASSEHWFSQLQLLKM 334 H + IPS++YS P Q ++V D +S HW + ++M Sbjct: 221 HPEEGRIPSFLYSPPPDFQVNSVIDDDGHTSLHWACSMGHIEM 263 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,603,851 Number of Sequences: 219361 Number of extensions: 1014755 Number of successful extensions: 1940 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1939 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)