| Clone Name | rbastl54e02 |
|---|---|
| Clone Library Name | barley_pub |
>TMK1_ARATH (P43298) Putative receptor protein kinase TMK1 precursor (EC| 2.7.11.1) Length = 942 Score = 35.0 bits (79), Expect = 0.044 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 372 IPTRPPGFADSFTSADGR 319 IPTRP GFA+SFTS DGR Sbjct: 925 IPTRPYGFAESFTSVDGR 942
>CUBN_CANFA (Q9TU53) Cubilin precursor| Length = 3620 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 123 GLPGNF*SKGHINTYMIKGELTWHATTRP 209 G G+F S G+ NTY E W+ TT P Sbjct: 1394 GTTGSFSSPGYPNTYPPNKECIWYITTAP 1422
>WNK4_HUMAN (Q96J92) Serine/threonine-protein kinase WNK4 (EC 2.7.11.1)| (Protein kinase with no lysine 4) (Protein kinase, lysine-deficient 4) Length = 1243 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 206 PCGGMPC*LSFDHVCIDVAFTLEIP 132 P GG+P L+ H+C+ AF L IP Sbjct: 604 PPGGVPSSLAESHLCLPSAFALSIP 628
>MTH1_DROME (Q9VXD9) Probable G-protein coupled receptor Mth-like 1 precursor| (Protein methuselah-like 1) Length = 676 Score = 28.5 bits (62), Expect = 4.1 Identities = 22/61 (36%), Positives = 28/61 (45%), Gaps = 6/61 (9%) Frame = +2 Query: 167 HDQRRANM---ACHH---KAKSSNIFKGREGGRGVEEAKGMNEQNDHLTGASDVAVYLPS 328 H QR + AC H A + I G GG +E+A G N Q LTG V++ S Sbjct: 286 HTQREGEVKIIACQHLFSSAAGAGIHDGSIGGT-IEQANGQNLQKAVLTGGILVSIVFLS 344 Query: 329 A 331 A Sbjct: 345 A 345
>XRN1_SCHPO (P40383) 5'-3' exoribonuclease 1 (EC 3.1.11.-) (Exonuclease 2)| (Exonuclease II) (Exo II) (p140) Length = 1328 Score = 27.7 bits (60), Expect = 7.1 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +2 Query: 152 PHQYIHDQR-RANMACHHKAKSSNIFKGREGGRGVE-EAKGMNEQNDHL 292 P IH + + + HH + +GR G RG +K +N ++DH+ Sbjct: 1270 PESLIHKSKSKFSKGNHHSTNGTQSIRGRGGKRGKPLRSKELNRKHDHI 1318
>PGLR1_MAIZE (P26216) Exopolygalacturonase precursor (EC 3.2.1.67) (ExoPG)| (Pectinase) (Galacturan 1,4-alpha-galacturonidase) Length = 410 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 14 LTMDQINVEYKPTNPKTI 67 +TMD +NVEY TN KT+ Sbjct: 373 VTMDDVNVEYSGTNNKTM 390
>GATA_COREF (Q8FPZ0) Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.-)| (Glu-ADT subunit A) Length = 497 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 23 DQINVEYKPTNPKTIFYLGSKLT 91 +Q++V PT P T F LG K+T Sbjct: 412 EQVDVLVSPTTPSTAFKLGDKIT 434
>PGLR2_MAIZE (P35338) Exopolygalacturonase precursor (EC 3.2.1.67) (ExoPG)| (Pectinase) (Galacturan 1,4-alpha-galacturonidase) Length = 410 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 Query: 17 TMDQINVEYKPTNPKTI 67 TMD +NVEY TN KT+ Sbjct: 374 TMDDVNVEYSGTNNKTM 390
>HEMO_RABIT (P20058) Hemopexin precursor| Length = 460 Score = 27.3 bits (59), Expect = 9.2 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 150 GHINTYMIKGELTWHATTRPNPATFLKA 233 GH + Y+IKG+ W T+ N + K+ Sbjct: 106 GHTSVYLIKGDKVWVYTSEKNEKVYPKS 133
>Y1195_ZYMMO (Q5NN91) UPF0078 membrane protein ZMO1195| Length = 218 Score = 27.3 bits (59), Expect = 9.2 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +2 Query: 221 IFKGREGGRGVEEAKGMNEQNDHLTGASDVAVYLPSAEVKESANPGGLVG 370 ++ G GG+GV G++ + G +L SA++ ++ GG+VG Sbjct: 114 VWLGFRGGKGVATMLGVSFAAWWVAGVVFAVAWLLSAKISRYSSVGGMVG 163 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,241,895 Number of Sequences: 219361 Number of extensions: 826473 Number of successful extensions: 2296 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2296 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)