| Clone Name | rbastl54b11 |
|---|---|
| Clone Library Name | barley_pub |
>APE2_YEAST (P32454) Aminopeptidase 2 (EC 3.4.11.-) (Aminopeptidase II) (AP-II)| (YscII) Length = 844 Score = 34.3 bits (77), Expect = 0.085 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = -1 Query: 274 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARW 164 S +K E+ +FFAT+ F+++L QSL+ + A+W Sbjct: 807 SMQKIDEIKKFFATKSTKGFDQSLAQSLDTITSKAQW 843
>RS6_RAT (P62755) 40S ribosomal protein S6| Length = 249 Score = 29.6 bits (65), Expect = 2.1 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = -1 Query: 274 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPS 137 ++E+AAE ++ A R+K + E+ +Q +R R+S+ + KSE S Sbjct: 202 NKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESS 247
>RS6_MOUSE (P62754) 40S ribosomal protein S6 (Phosphoprotein NP33)| Length = 249 Score = 29.6 bits (65), Expect = 2.1 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = -1 Query: 274 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPS 137 ++E+AAE ++ A R+K + E+ +Q +R R+S+ + KSE S Sbjct: 202 NKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESS 247
>RS6_HUMAN (P62753) 40S ribosomal protein S6 (Phosphoprotein NP33)| Length = 249 Score = 29.6 bits (65), Expect = 2.1 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = -1 Query: 274 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPS 137 ++E+AAE ++ A R+K + E+ +Q +R R+S+ + KSE S Sbjct: 202 NKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESS 247
>APE1_SCHPO (Q9USX1) Aminopeptidase 1 (EC 3.4.11.-) (Aminopeptidase I)| Length = 882 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = -1 Query: 256 EVSQFFATRVKPSFERALKQSLERVRISARWID 158 ++ +FFA + +ERAL+QSL+ + ++ +ID Sbjct: 834 KIKEFFADKDTKLYERALQQSLDTISANSSFID 866
>DFA1_SYNY3 (Q55393) Diflavin flavoprotein A 1 (EC 1.-.-.-) (SsATF573)| (NADH:oxygen oxidoreductase) Length = 573 Score = 27.7 bits (60), Expect = 8.0 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +2 Query: 140 GLALDAVDPSSADPHPLEALLQRSFERRLHASGKELG 250 G+ +D VD SSADP ++ L+ HASG LG Sbjct: 291 GVGVDMVDLSSADPQEIQELVG-------HASGVVLG 320 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,969,441 Number of Sequences: 219361 Number of extensions: 400425 Number of successful extensions: 1089 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1075 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1089 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)