| Clone Name | rbastl54a12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PDE6_CAEEL (Q9N2V9) Probable 3',5'-cyclic phosphodiesterase pde-... | 30 | 1.2 | 2 | SYI_PYRFU (P46214) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 29 | 3.6 | 3 | SYI_PYRHO (O58792) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 28 | 7.9 | 4 | SYI_PYRAB (Q9V072) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 28 | 7.9 |
|---|
>PDE6_CAEEL (Q9N2V9) Probable 3',5'-cyclic phosphodiesterase pde-6 (EC| 3.1.4.17) Length = 760 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -2 Query: 171 WRFWVLHSVAMRD*HAIGLIWLAFVTRRGWCFCVDCSDDKL 49 W+F +LH + D HA+ + + R C + CSDD L Sbjct: 444 WKFDILHLEKVSDHHALSQVGMKVFERWKVCDVLGCSDDLL 484
>SYI_PYRFU (P46214) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1066 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 190 VASEPRLALLGSTFRGDARLTCDWI 116 + +P A +G F+GDARL WI Sbjct: 900 ITVKPNFAKVGPEFKGDARLVAKWI 924
>SYI_PYRHO (O58792) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1066 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 181 EPRLALLGSTFRGDARLTCDWID 113 +P A +G F+GD+RL WI+ Sbjct: 903 KPNFAKVGPEFKGDSRLVAKWIN 925
>SYI_PYRAB (Q9V072) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1067 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 181 EPRLALLGSTFRGDARLTCDWID 113 +P A LG F+GDA++ WI+ Sbjct: 903 KPNFAKLGPEFKGDAKIIAKWIN 925 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,671,002 Number of Sequences: 219361 Number of extensions: 720488 Number of successful extensions: 1996 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1996 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)