| Clone Name | rbastl54a03 |
|---|---|
| Clone Library Name | barley_pub |
>PPK_BACHD (Q9KD27) Polyphosphate kinase (EC 2.7.4.1) (Polyphosphoric acid| kinase) (ATP-polyphosphate phosphotransferase) Length = 705 Score = 29.3 bits (64), Expect = 2.4 Identities = 15/70 (21%), Positives = 32/70 (45%) Frame = +2 Query: 14 IPSIHPYKIRQFTPFPVHERSQRDPLQPTRSEIRMGRKRRRILHGFFTGTNATDSLSFLV 193 + S+ P++I + P+HE RD L+ E++ + + G + L L+ Sbjct: 232 VKSVSPFRITRNADLPIHEEGARDLLREIEKELKKRKWGAAVRLEMQEGLMDPNVLKLLL 291 Query: 194 NLRHIFRQNV 223 ++ I + +V Sbjct: 292 DVLEIHKNDV 301
>SSB_WIGBR (Q8D254) Single-stranded DNA-binding protein (SSB)| (Helix-destabilizing protein) Length = 163 Score = 28.9 bits (63), Expect = 3.1 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +1 Query: 34 QDQAIHTISSP*TVTERSITTYQV-RDKNGEEEKENTTWLFYRDERHRFIVF 186 QD + I + +T S+ T + RDKN E KE T W HR I+F Sbjct: 17 QDPEVRYIPNGNAITNLSLATSENWRDKNTGESKEKTEW-------HRVILF 61
>LIPP_PIG (P00591) Pancreatic triacylglycerol lipase (EC 3.1.1.3) (Pancreatic| lipase) (PL) Length = 450 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 83 DPLQPTRSEIRMGRKRRRILHGF 151 DP T S RM RK R I+HGF Sbjct: 56 DPSTITNSNFRMDRKTRFIIHGF 78
>STAB2_MOUSE (Q8R4U0) Stabilin-2 precursor [Contains: Short form stabilin-2]| Length = 2559 Score = 27.3 bits (59), Expect = 9.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 96 GCNGSLCDRSWTGNGVNCL 40 G +C R WTGNG +C+ Sbjct: 899 GTYSCVCQRGWTGNGRDCV 917
>SSB_BRAJA (Q89L50) Single-stranded DNA-binding protein (SSB)| (Helix-destabilizing protein) Length = 164 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 73 VTERSITTYQV-RDKNGEEEKENTTWLFYRDERHRFIVFS 189 + SI T + RDKN E KE T W HR ++F+ Sbjct: 29 IANLSIATSETWRDKNSGERKEKTEW-------HRVVIFN 61 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,516,554 Number of Sequences: 219361 Number of extensions: 748625 Number of successful extensions: 1958 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1958 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)