| Clone Name | rbastl53h07 |
|---|---|
| Clone Library Name | barley_pub |
>DDB1_LYCES (Q6QNU4) DNA damage binding protein 1 (UV-damaged DNA-binding protein| 1) (High pigmentation protein 1) Length = 1090 Score = 40.8 bits (94), Expect = 8e-04 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 370 AKAMAVPVEELSKRVEELTRLH 305 +KAM+VPVEEL KRVEELTRLH Sbjct: 1069 SKAMSVPVEELMKRVEELTRLH 1090
>DDB1_LYCCS (Q6E7D1) DNA damage binding protein 1 (UV-damaged DNA-binding protein| 1) Length = 1095 Score = 40.8 bits (94), Expect = 8e-04 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -2 Query: 370 AKAMAVPVEELSKRVEELTRLH 305 +KAM+VPVEEL KRVEELTRLH Sbjct: 1074 SKAMSVPVEELMKRVEELTRLH 1095
>DDB1A_ARATH (Q9M0V3) DNA damage binding protein 1a (UV-damaged DNA-binding| protein 1a) (DDB1a) Length = 1088 Score = 35.4 bits (80), Expect = 0.034 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -2 Query: 370 AKAMAVPVEELSKRVEELTRLH 305 +K+M V VEEL KRVEELTRLH Sbjct: 1067 SKSMNVQVEELCKRVEELTRLH 1088
>DDB1B_ARATH (O49552) DNA damage binding protein 1b (UV-damaged DNA-binding| protein 1b) (DDB1b) Length = 1088 Score = 35.0 bits (79), Expect = 0.044 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 370 AKAMAVPVEELSKRVEELTRLH 305 +K M V VEEL KRVEELTRLH Sbjct: 1067 SKGMDVQVEELCKRVEELTRLH 1088
>HDC_HUMAN (Q9UBI9) Headcase protein homolog (hHDC)| Length = 543 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = -1 Query: 365 GDGGPCRGAVQAGGGADETALGSA---VPCTSCFICSF 261 G GG GA A A A G A PC + ICSF Sbjct: 65 GAGGAGTGAANAAAAAGAAAAGDAKNEAPCATPLICSF 102
>G168_PARPR (P17053) G surface protein, allelic form 168 precursor| Length = 2704 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +3 Query: 204 ATNTCRGSFSGRQRFTTQRKRTNKTGCTRHGAT*C 308 A TC + G +++ K GCT +GAT C Sbjct: 1637 AATTCDAVYLGTGNYSSANCNEMKAGCTNNGATAC 1671
>TRX_DROVI (Q24742) Protein trithorax| Length = 3828 Score = 28.1 bits (61), Expect = 5.4 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 90 VMFDNALLINNGDSPLK-FYISTDKVTLLSKSKTEKRNVATNTCRGS 227 V F N L ++ S +K FY ++V L+S K + N N CRGS Sbjct: 394 VTFKNILETSDDKSVVKRFYNPDNRVPLVSIMKKDSLNRPLNYCRGS 440
>SREP_PENCH (Q92259) GATA factor SREP| Length = 532 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -1 Query: 371 GQGDGGPCRGAVQAGGGADETALGSAVPCTSC 276 G +GG C+G+ GG + T G A C C Sbjct: 154 GSSEGGGCKGSCPGGGSCNGT--GGAEGCDGC 183
>ZN569_MOUSE (Q80W31) Zinc finger protein 569 (Zinc finger protein 74) (Zfp-74)| (Mszf21) Length = 679 Score = 27.7 bits (60), Expect = 7.1 Identities = 18/70 (25%), Positives = 31/70 (44%), Gaps = 9/70 (12%) Frame = +3 Query: 114 INNGDSPL------KFYISTDKVTLLSKSKTEKRNVATNTCRGSFSGRQRFTTQRK---R 266 ++ G+ P K + + +T+ +S T ++ CR SFS ++ F T +K R Sbjct: 368 VHTGEKPYECGECGKAFSQSSALTVHIRSHTGEKPYECKECRKSFSHKKNFITHQKIHTR 427 Query: 267 TNKTGCTRHG 296 GC G Sbjct: 428 EKPYGCNECG 437
>FBX27_HUMAN (Q8NI29) F-box only protein 27 (F-box/G-domain protein 5)| Length = 283 Score = 27.7 bits (60), Expect = 7.1 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 5/45 (11%) Frame = -1 Query: 365 GDGGPCRGAVQAGGGA-----DETALGSAVPCTSCFICSFSLCCK 246 G G + VQ GG + T + A P +CF+ SFS CCK Sbjct: 120 GQEGLRKWMVQHGGDGWVVEENRTTVPGA-PSQTCFVTSFSWCCK 163
>ERG28_ARATH (O80594) Probable ergosterol biosynthetic protein 28| Length = 110 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 287 CTSCFICSFSLCCKPL 240 CT CF+C+F+L KPL Sbjct: 55 CTLCFLCAFNLENKPL 70
>RPF53_MOUSE (Q8K202) DNA-directed RNA polymerase I-associated factor 53 kDa| subunit (EC 2.7.7.6) (RNA polymerase I-associated factor 1) Length = 482 Score = 27.3 bits (59), Expect = 9.3 Identities = 19/49 (38%), Positives = 23/49 (46%) Frame = +3 Query: 90 VMFDNALLINNGDSPLKFYISTDKVTLLSKSKTEKRNVATNTCRGSFSG 236 V F N L N GD Y STD L++ + R VA T R S+ G Sbjct: 41 VQFSNGKLQNPGDMRFTLYNSTD---LVNPRQRSHRIVAAETDRLSYVG 86 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,948,736 Number of Sequences: 219361 Number of extensions: 900508 Number of successful extensions: 2556 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2552 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)