| Clone Name | rbastl53e12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YT13_CAEEL (Q10917) Hypothetical protein B0252.3 in chromosome II | 31 | 0.89 | 2 | Y107_THEAC (Q9HLW7) UPF0290 protein Ta0107 | 29 | 3.4 | 3 | NRFD_HAEIN (P45014) Protein nrfD homolog | 28 | 4.4 | 4 | DCD_METJA (Q57872) dCTP deaminase, dUMP-forming (EC 3.5.4.30) (B... | 28 | 7.5 | 5 | MTFA_YERPS (Q667H7) Putative RNA 2'-O-ribose methyltransferase m... | 27 | 9.8 | 6 | MTFA_YERPE (Q8ZH78) Putative RNA 2'-O-ribose methyltransferase m... | 27 | 9.8 |
|---|
>YT13_CAEEL (Q10917) Hypothetical protein B0252.3 in chromosome II| Length = 484 Score = 30.8 bits (68), Expect = 0.89 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 Query: 185 HIHFCLFGSFNISCSITLVYL 123 HIHF L G F ISCS +Y+ Sbjct: 372 HIHFWLLGKFAISCSFMSIYM 392
>Y107_THEAC (Q9HLW7) UPF0290 protein Ta0107| Length = 176 Score = 28.9 bits (63), Expect = 3.4 Identities = 10/24 (41%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -2 Query: 198 WPICTYSFLFIRVLQ--YFMFHYF 133 WP +FLF+ + + +FM+HYF Sbjct: 121 WPFALMAFLFLYIFERPFFMYHYF 144
>NRFD_HAEIN (P45014) Protein nrfD homolog| Length = 321 Score = 28.5 bits (62), Expect = 4.4 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 7/58 (12%) Frame = -3 Query: 221 LDYPLPFHGP------SVHIHFCLFGSFNISCSITLVYLNHVRLDELI-S*IIRPDVI 69 LDYP+PFH P ++ I+ L G + + + + Y +L+ L + IIR VI Sbjct: 3 LDYPVPFHTPNLVWDYTIAIYLFLLGISSGAVQLAIAYKRSNKLENLSQNWIIRSGVI 60
>DCD_METJA (Q57872) dCTP deaminase, dUMP-forming (EC 3.5.4.30) (Bifunctional| deaminase/diphosphatase) (MjDCD-DUT) (DCD/DUT) Length = 204 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 176 NEYVQMGHEMEADNQGRHRLAKPI*TKLVRSGW 274 NEY+++ +++ A QGR L + T +GW Sbjct: 101 NEYIELPNDISAQYQGRSSLGRVFLTSHQTAGW 133
>MTFA_YERPS (Q667H7) Putative RNA 2'-O-ribose methyltransferase mtfA (EC| 2.1.1.-) Length = 368 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 6/36 (16%) Frame = -3 Query: 299 NLAETSKTTTH------F*PTWSKLVWLICDALDYP 210 +L +T + T H + PT S + WL+CD ++ P Sbjct: 248 SLMDTGQVTHHRADGFKYEPTRSNIYWLVCDMVEKP 283
>MTFA_YERPE (Q8ZH78) Putative RNA 2'-O-ribose methyltransferase mtfA (EC| 2.1.1.-) Length = 368 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 6/36 (16%) Frame = -3 Query: 299 NLAETSKTTTH------F*PTWSKLVWLICDALDYP 210 +L +T + T H + PT S + WL+CD ++ P Sbjct: 248 SLMDTGQVTHHRADGFKYEPTRSNIYWLVCDMVEKP 283 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,397,580 Number of Sequences: 219361 Number of extensions: 905474 Number of successful extensions: 1501 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1500 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)