| Clone Name | rbastl53e05 |
|---|---|
| Clone Library Name | barley_pub |
>LTBP3_MOUSE (Q61810) Latent transforming growth factor beta-binding protein 3| precursor (LTBP-3) Length = 1268 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +3 Query: 162 HDNYGSRSNTGHEDCAALSSLEPFPFALTIWLFLELYRSYRCHCTR 299 H N G RS+ H C ++ E P + + SY CHC R Sbjct: 596 HCNAGYRSHPQHRYCVDVNECEAEPCGPGKGICMNTGGSYNCHCNR 641
>POLN_FCVC6 (P27407) Non-structural polyprotein [Contains: p5.6; p32; Helicase| (2C-like protein) (p39); 3A-like protein (p30); Viral genome-linked protein (VPg) (p13); Thiol protease P3C (EC 3.4.22.-) (3C-like protease) (3C-pro); RNA-directed RNA polymera Length = 1762 Score = 30.0 bits (66), Expect = 1.5 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = -2 Query: 183 NVTHNC-----RVGQEAWRLTAFPALHHVVRINVCFFFSFCLRRFKSL 55 ++TH C ++ ++ RL PA HVV +N F ++ LRR +L Sbjct: 779 DLTHLCHFIKGKIVNDSVRLDELPANQHVVTVNSVFDLAWALRRHSTL 826
>LTBP3_HUMAN (Q9NS15) Latent transforming growth factor beta-binding protein 3| precursor (LTBP-3) Length = 1302 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +3 Query: 162 HDNYGSRSNTGHEDCAALSSLEPFPFALTIWLFLELYRSYRCHCTR 299 H N G RS+ H C ++ E P + + SY CHC R Sbjct: 599 HCNPGYRSHPQHRYCVDVNECEAEPCGPGRGICMNTGGSYNCHCNR 644
>POLN_FCVUR (Q66914) Non-structural polyprotein [Contains: p5.6; p32; Helicase| (2C-like protein) (p39); 3A-like protein (p30); Viral genome-linked protein (VPg) (p13); Thiol protease P3C (EC 3.4.22.-) (3C-like protease) (3C-pro); RNA-directed RNA polymera Length = 1763 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = -2 Query: 183 NVTHNC-----RVGQEAWRLTAFPALHHVVRINVCFFFSFCLRRFKSL 55 ++TH C ++ ++ RL PA HVV +N F ++ LRR +L Sbjct: 780 DLTHLCHFIRGKIVNDSVRLDELPANQHVVTVNSVFDLAWALRRHLTL 827
>L_EBOSM (Q66802) Large structural protein (L protein) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2210 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +1 Query: 67 PSEAKGKKKANINTYNMMKSGEGRKPPGLLSNTTIMGHVPTRDMKIVQ 210 P + G KA + ++ G +PPGL N + +PTR +IVQ Sbjct: 1648 PKKTIGATKATTAPHIILPLGNSDRPPGLDLNQSNDTFIPTRIKQIVQ 1695
>YDN1_SCHPO (P87293) Hypothetical protein C16A10.01 in chromosome I| Length = 830 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/52 (25%), Positives = 22/52 (42%) Frame = +1 Query: 55 KTFEPSEAKGKKKANINTYNMMKSGEGRKPPGLLSNTTIMGHVPTRDMKIVQ 210 ++F + N TYN++ P +S T M H P+ K++Q Sbjct: 218 QSFNSASRSSSISGNQYTYNLLGKSTDESPKITISAGTSMSHFPSASSKLIQ 269
>SYL_COREF (Q8FLM0) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 957 Score = 27.7 bits (60), Expect = 7.6 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +3 Query: 192 GHEDCAALSSLEPFPFALTIWLFLELYRSY 281 GH+ A++S +P + T W+FL+++ S+ Sbjct: 147 GHDPRRAVASTDPEFYKWTQWIFLQIFNSW 176
>SYL_STRAW (Q82C66) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 962 Score = 27.3 bits (59), Expect = 10.0 Identities = 9/34 (26%), Positives = 21/34 (61%) Frame = +3 Query: 180 RSNTGHEDCAALSSLEPFPFALTIWLFLELYRSY 281 R GH+ + ++++P + T W+FL+++ S+ Sbjct: 141 RLGLGHDKRRSFATIDPDYYKWTQWIFLQIFNSW 174
>STE11_YEAST (P23561) Serine/threonine-protein kinase STE11 (EC 2.7.11.1)| Length = 738 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/53 (24%), Positives = 27/53 (50%) Frame = +1 Query: 55 KTFEPSEAKGKKKANINTYNMMKSGEGRKPPGLLSNTTIMGHVPTRDMKIVQR 213 K + A+GK + + + ++ ++PP +T + G+ P DMK +Q+ Sbjct: 271 KGISHNNAEGKLRIDNTEKDRIRQIFNQRPPSEFISTNLAGYFPHTDMKRLQK 323
>NNP1_HUMAN (P56182) NNP-1 protein (Novel nuclear protein 1) (Nucleolar protein| Nop52) (D21S2056E) Length = 461 Score = 27.3 bits (59), Expect = 10.0 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 Query: 38 PDTSSRRLLNRRRQKEKKKQ 97 P+ + RRLL RRQK+ KKQ Sbjct: 345 PEKACRRLLEGRRQKKTKKQ 364
>RTN2_HUMAN (O75298) Reticulon-2 (Neuroendocrine-specific protein-like 1)| (NSP-like protein 1) (NSPLI) Length = 545 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 241 AKGNGSREDSAAQSSCPVLERDP 173 A+G GS EDS+ SS P+ + +P Sbjct: 151 ARGTGSGEDSSTSSSTPLEDEEP 173 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,876,839 Number of Sequences: 219361 Number of extensions: 830740 Number of successful extensions: 1903 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1865 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1903 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)