| Clone Name | rbastl53e01 |
|---|---|
| Clone Library Name | barley_pub |
>HIRA_MOUSE (Q61666) HIRA protein (TUP1-like enhancer of split protein 1)| Length = 1015 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = +2 Query: 251 WNL---LVSPCDLAGSTTH--QGFYCPSGRQLLSRSSFNRGG 361 W L + PCD G TTH + + P G L+S + N G Sbjct: 206 WQLETSITKPCDECGGTTHVLRLSWSPDGHYLVSAHAMNNSG 247
>YAEC_SCHPO (Q09852) Putative inorganic phosphate transporter C23D3.12| Length = 559 Score = 27.7 bits (60), Expect = 7.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 200 VQRSGKKKVHHGLW*WYWN 256 V R G K H G W WY+N Sbjct: 538 VLRGGNGKTHQGRWSWYFN 556
>ATG26_CRYNE (Q5KK25) Sterol 3-beta-glucosyltransferase (EC 2.4.1.173)| (Autophagy-related protein 26) Length = 1585 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 366 PPPPLLNDDLESSWRPEGQ*KP 301 PPPP +NDD +WRP KP Sbjct: 718 PPPPSMNDDAR-NWRPSWIRKP 738
>VILI4_ARATH (O65570) Villin-4| Length = 974 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 280 QITRTYQQIPVPSPKSMMNLFFSTSLYIKLK 188 +I R IP P PKS + FF+ YI LK Sbjct: 22 EIWRIENFIPTPIPKSSIGKFFTGDSYIVLK 52
>DP2L_ARCFU (O28552) DNA polymerase II large subunit (EC 2.7.7.7) (Pol II)| Length = 1143 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 272 CDLAGSTTHQGFYCPSGR 325 CD+ G T Q +YCPS R Sbjct: 663 CDVCGELTEQLYYCPSCR 680
>NOS_DROME (Q27571) Nitric-oxide synthase (EC 1.14.13.39) (dNOS)| Length = 1349 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +1 Query: 124 LSYIGXXXXXXXXXXQLMHMGFLILCTEK-WKKKGSSWTLV 243 +SY G M++ F +CT+ WK KGS W ++ Sbjct: 393 ISYAGYKQADGKIIGDPMNVEFTEVCTKLGWKSKGSEWDIL 433 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,924,346 Number of Sequences: 219361 Number of extensions: 1239202 Number of successful extensions: 2348 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2299 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2347 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)