| Clone Name | rbastl53d11 |
|---|---|
| Clone Library Name | barley_pub |
>TAF7_YEAST (Q05021) Transcription initiation factor TFIID subunit 7| (TBP-associated factor 7) (TBP-associated factor 67 kDa) (TAFII-67) Length = 590 Score = 31.2 bits (69), Expect = 0.69 Identities = 20/68 (29%), Positives = 35/68 (51%) Frame = +1 Query: 76 RPKCKHEFRQSDHSKYGREDG*KKSLQRECRVLPSSRSRETSKNKHRALPLLLVAVRCPG 255 +PK K ++ S G+E K SL+ + + ++ E K H+A L L +R PG Sbjct: 42 KPKLKINLKKKKESADGKEK--KNSLKLKLNL---KKNEEPVKKIHKAPKLRLKPIRIPG 96 Query: 256 EGLEAESN 279 E ++E++ Sbjct: 97 EAYDSEAS 104
>NU5M_TRIRE (Q8SHP7) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3)| Length = 692 Score = 27.7 bits (60), Expect = 7.6 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -3 Query: 162 FSL*AFFLPIFSSVLAMV---RLPKLVFAFGPTN 70 F L FFL IF SVL++V +PK+V F TN Sbjct: 509 FKLLPFFLTIFFSVLSIVYYEYMPKVVVDFNLTN 542
>PPIG_HUMAN (Q13427) Peptidyl-prolyl cis-trans isomerase G (EC 5.2.1.8)| (Peptidyl-prolyl isomerase G) (PPIase G) (Rotamase G) (Cyclophilin G) (Clk-associating RS-cyclophilin) (CARS-cyclophilin) (CARS-Cyp) (SR-cyclophilin) (SRcyp) (SR-cyp) (CASP10) Length = 754 Score = 27.3 bits (59), Expect = 9.9 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Frame = +1 Query: 103 QSDHSKYGREDG*KKSLQRECRVLP-----SSRSRETSKNKHRA 219 + DHSK +D +S REC + +SR+RE S+++ R+ Sbjct: 529 EHDHSKSKEKDRRAQSRSRECDITKGKHSYNSRTRERSRSRDRS 572
>DNLJ_THEFI (Q9ZHI0) DNA ligase (EC 6.5.1.2) (Polydeoxyribonucleotide synthase| [NAD+]) (Tfi DNA ligase) Length = 670 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 190 RETSKNKHRALPLLLVAVRCPGEGLEAESNLPR 288 R+ ++KHR L LL A+ PG G NL R Sbjct: 496 RQIEESKHRGLERLLYALGLPGVGEVLARNLAR 528
>IFRH_ARATH (P52577) Isoflavone reductase homolog P3 (EC 1.3.1.-)| Length = 310 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 47 PSVLNKLKFVGPNANTSLGNRTIASTEEKMGR 142 P LNK+ ++ P+ NT N + E+K+G+ Sbjct: 208 PRTLNKILYIKPSNNTLSMNEIVTLWEKKIGK 239 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,433,261 Number of Sequences: 219361 Number of extensions: 919335 Number of successful extensions: 2288 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2268 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2287 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)