| Clone Name | rbastl53d09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y4NK_RHISN (P55583) Hypothetical 72.8 kDa protein y4nK | 31 | 0.90 | 2 | SNF5_CHICK (Q5ZK40) SWI/SNF-related, matrix-associated, actin-de... | 28 | 7.6 | 3 | NAS27_CAEEL (O17264) Zinc metalloproteinase nas-27 precursor (EC... | 28 | 7.6 | 4 | GBRB4_CHICK (P24045) Gamma-aminobutyric-acid receptor beta-4 sub... | 28 | 7.6 |
|---|
>Y4NK_RHISN (P55583) Hypothetical 72.8 kDa protein y4nK| Length = 662 Score = 30.8 bits (68), Expect = 0.90 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 11/75 (14%) Frame = -1 Query: 195 FDATSWFRILF----------CLSYAFFEFGRVGNVELFLFAVGSSACSFCCEM-TVSKL 49 FD+ + R+L ++ + F F + + L L +G SA +F T+ L Sbjct: 34 FDSNTTMRLLLSPVIGLGIFGAVAVSIFHFLPITAINLMLIVLGLSAVAFWLSKGTIDPL 93 Query: 48 LISSVCPLGPRFCWF 4 L S P P FCWF Sbjct: 94 LRS---PASPGFCWF 105
>SNF5_CHICK (Q5ZK40) SWI/SNF-related, matrix-associated, actin-dependent| regulator of chromatin subfamily B member 1 Length = 386 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +2 Query: 92 EPTAKRNNSTFPTLPNSKN 148 E AKRNN PTLPNS + Sbjct: 123 EQKAKRNNQWVPTLPNSSH 141
>NAS27_CAEEL (O17264) Zinc metalloproteinase nas-27 precursor (EC 3.4.24.21)| (Nematode astacin 27) Length = 428 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -1 Query: 90 SACSFCCEMTVSKLLISSVCPLGPRFC 10 S CS C +L +S+ GPRFC Sbjct: 360 SPCSMSCSFNALELKLSNFTMTGPRFC 386
>GBRB4_CHICK (P24045) Gamma-aminobutyric-acid receptor beta-4 subunit precursor| (GABA(A) receptor) Length = 488 Score = 27.7 bits (60), Expect = 7.6 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = -1 Query: 261 RCSASFRPKNVNGPQRLRCPDLFDATS---WFRILFCLSYAFF 142 R A+ R + + +L+ PDL D ++ W RI+F +++ FF Sbjct: 436 RNRANCRLRRRSSKLKLKIPDLTDVSTIDKWSRIIFPITFGFF 478 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,854,098 Number of Sequences: 219361 Number of extensions: 908719 Number of successful extensions: 2095 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2073 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2092 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)