| Clone Name | rbastl53d04 |
|---|---|
| Clone Library Name | barley_pub |
>CYB_CAEEL (P24890) Cytochrome b| Length = 370 Score = 33.5 bits (75), Expect = 0.15 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = -3 Query: 129 FQLFHFGMVGHLFLFSSKPWLLLFCFQPLYFPSSRRWKIWLSG 1 F++FHF F+F L L F+ L+F S R K+W+SG Sbjct: 76 FRIFHFNGASLFFIF-----LYLHIFKGLFFMSYRLKKVWMSG 113
>CYB_CAEBR (Q8HEC2) Cytochrome b| Length = 370 Score = 32.7 bits (73), Expect = 0.25 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = -3 Query: 129 FQLFHFGMVGHLFLFSSKPWLLLFCFQPLYFPSSRRWKIWLSG 1 F++FHF F+F L L F L+F S R K+W+SG Sbjct: 76 FRIFHFNGASLFFIF-----LYLHIFTGLFFMSYRLKKVWMSG 113
>CCD37_MOUSE (Q80VN0) Coiled-coil domain-containing protein 37| Length = 459 Score = 30.8 bits (68), Expect = 0.94 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 8/56 (14%) Frame = +3 Query: 3 LTAKSSTVYLTGSKGAGNRKEEAMVWKR--------KETNVLPYQNGRAEMLPKIG 146 LT +ST L G KG+G++ + A +WK K ++ + + LP++G Sbjct: 140 LTRNNSTAILFGDKGSGSKSKTAFLWKEVPGLKKVTKTGRLVKALSSSIQSLPQVG 195
>CYB_ASCSU (P24878) Cytochrome b| Length = 365 Score = 30.4 bits (67), Expect = 1.2 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 129 FQLFHFGMVGHLFLFSSKPWLLLFCFQPLYFPSSRRWKIWLSG 1 F++ HF F+F L L F+ L+F S R K+W+SG Sbjct: 71 FRVLHFNGASLFFIF-----LYLHLFKGLFFMSYRLKKVWVSG 108
>FBX44_MOUSE (Q8BK26) F-box only protein 44 (F-box only protein 6a)| Length = 255 Score = 30.0 bits (66), Expect = 1.6 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = -1 Query: 233 NVKGSSQDCTVDVFAHRKVAKLIIRANPVTDLWQHFSSSILVW 105 N+ ++ +++F H +L++R PV LW+ + +W Sbjct: 5 NINELPENILLELFIHIPARQLLLRCRPVCSLWRDLIDLVTLW 47
>CRYD_BRARE (Q4KML2) Cryptochrome DASH (Protein CRY-DASH) (zCRY-DASH)| Length = 520 Score = 28.9 bits (63), Expect = 3.6 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -3 Query: 141 SLATFQLFHFGMVGHLFLFSSKPWLLLFCFQPLY 40 ++AT++ GM+G F PWL L C P Y Sbjct: 235 AVATYKETRNGMIGVDFSTKFSPWLALGCISPRY 268
>ATP6_RABIT (O79432) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 226 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = -2 Query: 124 ALPFWYGRTFVSFLFQTMASSFLF-----PAPLLPVK*TVEDLAV 5 A+P W G F ++T AS F P PL+P+ +E +++ Sbjct: 105 AIPLWAGAVITGFRYKTKASLAHFLPQGTPIPLIPMLIVIETISL 149
>ATP6_CANFA (Q9ZZ62) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 226 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = -2 Query: 124 ALPFWYGRTFVSFLFQTMASSFLF-----PAPLLPVK*TVEDLAV 5 A+P W G F ++T AS F P PL+P+ +E +++ Sbjct: 105 AIPLWAGTVITGFRYKTKASLAHFLPQGTPLPLIPMLVVIETISL 149
>S14L3_HUMAN (Q9UDX4) SEC14-like protein 3 (Tocopherol-associated protein 2)| Length = 400 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +3 Query: 93 TNVLPYQNGRAEMLPKIGNRVCSD 164 T+VLP Q A M+P+ GN CS+ Sbjct: 334 TDVLPSQRYNAHMVPEDGNLTCSE 357
>YE15_CAEEL (Q18473) Hypothetical protein C35A5.5| Length = 520 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 3/25 (12%) Frame = -3 Query: 69 LLLFCFQ---PLYFPSSRRWKIWLS 4 L+L CF P+YFP++ + +WLS Sbjct: 31 LILICFYFIIPIYFPNNDKMNLWLS 55
>CRYD_OSTTA (Q5IFN2) Cryptochrome DASH, chloroplast/mitochondrial precursor| Length = 546 Score = 27.7 bits (60), Expect = 8.0 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 5/74 (6%) Frame = -3 Query: 228 KRLLPGLYSRCVRA*KGSKANNPSKPCYR-----SLATFQLFHFGMVGHLFLFSSKPWLL 64 KR+ L R V KG ++N ++ Y LAT+ GM+G + PWL Sbjct: 229 KRIKDCLDERSVLDFKGGESNALARVKYYLWESDRLATYFETRNGMLGGDYSTKLAPWLA 288 Query: 63 LFCFQPLYFPSSRR 22 L C P + S R Sbjct: 289 LGCVSPRHVVSEIR 302 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,182,618 Number of Sequences: 219361 Number of extensions: 824168 Number of successful extensions: 2124 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2124 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)