| Clone Name | rbastl53b06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SUBL_ARATH (O65351) Subtilisin-like protease precursor (EC 3.4.2... | 40 | 0.002 | 2 | CUCM1_CUCME (Q39547) Cucumisin precursor (EC 3.4.21.25) (Allerge... | 29 | 2.6 | 3 | MOT1_HUMAN (P53985) Monocarboxylate transporter 1 (MCT 1) | 28 | 4.5 | 4 | MTSS1_MOUSE (Q8R1S4) Metastasis suppressor protein 1 (Missing in... | 28 | 4.5 |
|---|
>SUBL_ARATH (O65351) Subtilisin-like protease precursor (EC 3.4.21.-)| (Cucumisin-like serine protease) Length = 757 Score = 40.0 bits (92), Expect = 0.002 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -3 Query: 292 FGRLVWSDGKHTVASPIALTWT 227 FG + WSDGKH V SP+A++WT Sbjct: 736 FGSIEWSDGKHVVGSPVAISWT 757
>CUCM1_CUCME (Q39547) Cucumisin precursor (EC 3.4.21.25) (Allergen Cuc m 1)| Length = 731 Score = 29.3 bits (64), Expect = 2.6 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 283 LVWSDGKHTVASPIALT 233 LVWSDG H V SPI +T Sbjct: 712 LVWSDGVHYVRSPITIT 728
>MOT1_HUMAN (P53985) Monocarboxylate transporter 1 (MCT 1)| Length = 500 Score = 28.5 bits (62), Expect = 4.5 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +2 Query: 56 MIGPY*HFEIFERYHQISSFSSPESPQFY-TLNPFGRTSSGVSSWRSAWAVLGAPVKSC 229 MIG Y ++R + + SP F TL P + G+ WR ++ +LG + +C Sbjct: 134 MIGKY----FYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNC 188
>MTSS1_MOUSE (Q8R1S4) Metastasis suppressor protein 1 (Missing in metastasis| protein) Length = 759 Score = 28.5 bits (62), Expect = 4.5 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Frame = +2 Query: 2 TQSLSIITISPPNHNLKVMIGPY*HFEIFERY-HQISSFSSPESPQFYTLNPFGRTSSGV 178 + S ++S +H V GP+ H R +++S P+ +YT+ P SS + Sbjct: 351 SNGFSHCSLSSESHAGPVGAGPFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMFPSSQI 410 Query: 179 SSWRSAWAVLG 211 SW+ WA G Sbjct: 411 PSWKD-WAKPG 420 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,233,132 Number of Sequences: 219361 Number of extensions: 876419 Number of successful extensions: 2251 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2194 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2251 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)