| Clone Name | rbastl47h02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NU4LM_DIDMA (P41307) NADH-ubiquinone oxidoreductase chain 4L (EC... | 30 | 1.3 | 2 | Y1082_PELUB (Q4FLQ2) UPF0078 membrane protein SAR11_1082 | 28 | 6.3 |
|---|
>NU4LM_DIDMA (P41307) NADH-ubiquinone oxidoreductase chain 4L (EC 1.6.5.3) (NADH| dehydrogenase subunit 4L) Length = 98 Score = 30.4 bits (67), Expect = 1.3 Identities = 17/50 (34%), Positives = 30/50 (60%) Frame = -2 Query: 228 GLLFTLRIFSAAFVYQYRLISMANFCLLLPCMLLVFFTFDSIAVLVLLVS 79 G++ +L IF AA + + + S++ ++P +LLVF ++ L LLVS Sbjct: 35 GMMLSLFIFMAAMITHFHMFSIS----MMPLILLVFSACEAGVGLALLVS 80
>Y1082_PELUB (Q4FLQ2) UPF0078 membrane protein SAR11_1082| Length = 191 Score = 28.1 bits (61), Expect = 6.3 Identities = 14/51 (27%), Positives = 28/51 (54%) Frame = -2 Query: 234 WLGLLFTLRIFSAAFVYQYRLISMANFCLLLPCMLLVFFTFDSIAVLVLLV 82 +LGL+F + + +Y +S L++P L+VF ++SI +++ V Sbjct: 117 FLGLVFIISWAVTFLISKYSSLSSLVGSLMVPMYLIVFENYNSIFFIIMFV 167 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,100,896 Number of Sequences: 219361 Number of extensions: 391291 Number of successful extensions: 893 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 893 length of database: 80,573,946 effective HSP length: 58 effective length of database: 67,851,008 effective search space used: 1628424192 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)