| Clone Name | rbastl47f08 |
|---|---|
| Clone Library Name | barley_pub |
>POLG_BVDVC (Q96662) Genome polyprotein [Contains: N-terminal protease (EC| 3.4.22.-) (N-pro) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); p7; Nonstructural protein 2 Length = 3907 Score = 29.6 bits (65), Expect = 2.2 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -3 Query: 97 NIASVCLEGNCRVCNSFSPLCGYYTMPG 14 N+AS+ G+CR NS P+ G Y PG Sbjct: 59 NLASLPKRGDCRSGNSKGPVSGIYLKPG 86
>POLG_BVDVN (P19711) Genome polyprotein [Contains: N-terminal protease (EC| 3.4.22.-) (N-pro) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); p7; Nonstructural protein 2 Length = 3988 Score = 29.6 bits (65), Expect = 2.2 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -3 Query: 97 NIASVCLEGNCRVCNSFSPLCGYYTMPG 14 N+AS+ G+CR NS P+ G Y PG Sbjct: 59 NLASLPKRGDCRSGNSRGPVSGIYLKPG 86
>LPXD_HAEIN (P43888) UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase| (EC 2.3.1.-) Length = 341 Score = 28.9 bits (63), Expect = 3.7 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 115 VLAGSLNIASVCLEGNCRVCNSFSPLCGYYTMPG 14 ++AGSL + CL G V N +C T+ G Sbjct: 257 IMAGSLTVGRYCLIGGASVINGHMEICDKVTITG 290
>LPXD_PASMU (Q9CJL0) UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase| (EC 2.3.1.-) Length = 342 Score = 28.9 bits (63), Expect = 3.7 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 115 VLAGSLNIASVCLEGNCRVCNSFSPLCGYYTMPG 14 ++AGSL + CL G V N +C T+ G Sbjct: 256 IMAGSLTVGRYCLIGGASVINGHMEICDKVTITG 289
>POLG_BVDVS (Q01499) Genome polyprotein [Contains: N-terminal protease (EC| 3.4.22.-) (N-pro) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); p7; Nonstructural protein 2 Length = 3898 Score = 27.7 bits (60), Expect = 8.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 97 NIASVCLEGNCRVCNSFSPLCGYYTMPG 14 ++AS+ G+CR NS P+ G Y PG Sbjct: 59 SLASLPKRGDCRSGNSKGPVSGIYLKPG 86 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,837,792 Number of Sequences: 219361 Number of extensions: 620699 Number of successful extensions: 1326 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1326 length of database: 80,573,946 effective HSP length: 58 effective length of database: 67,851,008 effective search space used: 1628424192 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)