| Clone Name | rbastl47b10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YIF1A_BRARE (Q6PC24) Protein YIF1A (YIP1-interacting factor homo... | 28 | 4.9 | 2 | YCF2_MARPO (P09975) Protein ycf2 | 28 | 8.4 |
|---|
>YIF1A_BRARE (Q6PC24) Protein YIF1A (YIP1-interacting factor homolog A)| Length = 307 Score = 28.5 bits (62), Expect = 4.9 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 79 VICKITLGSNSYFLILTYSTCKFNFPRLIRIICFRLSFSILSSV 210 V C + GS+ Y++ L +S+C F I L ILSS+ Sbjct: 229 VFCGLLFGSDGYYVALAWSSCALMF-----FIVRSLKMKILSSI 267
>YCF2_MARPO (P09975) Protein ycf2| Length = 2136 Score = 27.7 bits (60), Expect = 8.4 Identities = 9/30 (30%), Positives = 21/30 (70%) Frame = +1 Query: 124 LTYSTCKFNFPRLIRIICFRLSFSILSSVV 213 LTY+ K NF R+ +I+ +++ +I+ +++ Sbjct: 1623 LTYTNNKLNFDRIFKIVIYKVGKTIIQNIL 1652 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,967,130 Number of Sequences: 219361 Number of extensions: 456559 Number of successful extensions: 937 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)