| Clone Name | rbastl47a11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PYRB_BACTN (Q8A9S3) Aspartate carbamoyltransferase (EC 2.1.3.2) ... | 30 | 1.2 | 2 | YCF2_MARPO (P09975) Protein ycf2 | 30 | 1.6 | 3 | CEMA_PORPU (P51232) Chloroplast envelope membrane protein | 29 | 2.7 | 4 | YIF1A_BRARE (Q6PC24) Protein YIF1A (YIP1-interacting factor homo... | 28 | 4.5 |
|---|
>PYRB_BACTN (Q8A9S3) Aspartate carbamoyltransferase (EC 2.1.3.2) (Aspartate| transcarbamylase) (ATCase) Length = 313 Score = 30.4 bits (67), Expect = 1.2 Identities = 18/69 (26%), Positives = 36/69 (52%) Frame = -2 Query: 260 CRNDFPKFRKHTEQKGTTEDNIEKESLKHMILIRRGKLNLQVEYVSIRK*LLLPNVILQM 81 C+ K+ +HTE TE+ I + +M ++R + +EY ++ +L N +L+ Sbjct: 196 CKEHQIKYIEHTE---FTEEIIADADILYMTRVQRERFTDLMEYERVKNVYILRNKMLEN 252 Query: 80 TKLTVNILY 54 T+ + IL+ Sbjct: 253 TRPNLRILH 261
>YCF2_MARPO (P09975) Protein ycf2| Length = 2136 Score = 30.0 bits (66), Expect = 1.6 Identities = 13/42 (30%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +1 Query: 124 LTYSTCKFNFPRLIRIICFRLSFSILSSV-VPFCSVCFLNLG 246 LTY+ K NF R+ +I+ +++ +I+ ++ + S+ LN+G Sbjct: 1623 LTYTNNKLNFDRIFKIVIYKVGKTIIQNILIKSSSMNLLNIG 1664
>CEMA_PORPU (P51232) Chloroplast envelope membrane protein| Length = 278 Score = 29.3 bits (64), Expect = 2.7 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -2 Query: 278 GPVPERCRNDFPKFRKHTEQKGTTEDNIEKESLKHMILIRRGKLNLQVEYVSIRK*LLLP 99 GP+P N F KFRK + G E E+++ L R + V+Y+ + L+ P Sbjct: 18 GPIPRSITNTFEKFRKELDPNG------ESEAIEEFRLSRHQTIT-SVKYIFLL--LISP 68 Query: 98 NVILQMTK 75 ++ Q +K Sbjct: 69 VLVNQASK 76
>YIF1A_BRARE (Q6PC24) Protein YIF1A (YIP1-interacting factor homolog A)| Length = 307 Score = 28.5 bits (62), Expect = 4.5 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 79 VICKITLGSNSYFLILTYSTCKFNFPRLIRIICFRLSFSILSSV 210 V C + GS+ Y++ L +S+C F I L ILSS+ Sbjct: 229 VFCGLLFGSDGYYVALAWSSCALMF-----FIVRSLKMKILSSI 267 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,502,024 Number of Sequences: 219361 Number of extensions: 727472 Number of successful extensions: 1717 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1717 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)