| Clone Name | rbastl47a05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PYR5_FREDI (P11401) Phycobilisome 37.5 kDa linker polypeptide, p... | 32 | 0.93 | 2 | TAB3_XENLA (Q7ZXH3) Mitogen-activated protein kinase kinase kina... | 30 | 3.5 | 3 | ENV_FIVU2 (Q04993) Env polyprotein (GP150 polyprotein) [Contains... | 30 | 3.5 |
|---|
>PYR5_FREDI (P11401) Phycobilisome 37.5 kDa linker polypeptide,| phycocyanin-associated, rod (L-37.5/R) Length = 268 Score = 31.6 bits (70), Expect = 0.93 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +1 Query: 247 IHQYVTKEYRNKTAKLLHDHQQHNLYGYRY*PHIYALQLSP*RRTVGYSRMVQ 405 ++ Y K Y + + + +G R PH + P ++TVG++RM Q Sbjct: 114 VNLYTEKGYEAEINSYIDSAEYQESFGERIVPHYRGFETQPGQKTVGFNRMFQ 166
>TAB3_XENLA (Q7ZXH3) Mitogen-activated protein kinase kinase kinase| 7-interacting protein 3 homolog Length = 692 Score = 29.6 bits (65), Expect = 3.5 Identities = 8/25 (32%), Positives = 18/25 (72%) Frame = +3 Query: 216 IPECFLQDHSDTSVCYKRIQEQNCK 290 + +C LQ++S+ CY+ + +++CK Sbjct: 28 VSQCMLQNNSNLDACYRALTQESCK 52
>ENV_FIVU2 (Q04993) Env polyprotein (GP150 polyprotein) [Contains: Major| glycoprotein GP100; Glycoprotein GP36] Length = 855 Score = 29.6 bits (65), Expect = 3.5 Identities = 23/87 (26%), Positives = 36/87 (41%) Frame = -2 Query: 280 CSCILL*HTDVSEWSCKKHSGMLEIWANIPRMLLRHFIIMTALCVHLWGF*ILKSLQFMF 101 C+C TD ++ +C K G+L W N P LR +SL+ Sbjct: 547 CNCTNSSSTDSNKMACPKRQGILRNWYN-PVAGLR------------------QSLEKYQ 587 Query: 100 TIKFFSSLIIPEKQADFKPRIKVTCGH 20 +K L++P + ++KPR K H Sbjct: 588 VVKQPDYLVVPREVMEYKPRRKRAAIH 614 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,174,229 Number of Sequences: 219361 Number of extensions: 1247463 Number of successful extensions: 2682 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2679 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)