| Clone Name | rbastl46h04 |
|---|---|
| Clone Library Name | barley_pub |
>TNF10_HUMAN (P50591) Tumor necrosis factor ligand superfamily member 10| (TNF-related apoptosis-inducing ligand) (TRAIL protein) (Apo-2 ligand) (Apo-2L) (CD253 antigen) Length = 281 Score = 29.6 bits (65), Expect = 2.9 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 294 SAW*EIRSSHGYAKNLHVQNGDLM 365 ++W RS H + NLH++NG+L+ Sbjct: 152 NSWESSRSGHSFLSNLHLRNGELV 175
>ODFP_MOUSE (Q61999) Outer dense fiber protein| Length = 247 Score = 28.9 bits (63), Expect = 4.9 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -3 Query: 66 CMSYVTVHPYCCA-LHMIPVCL 4 C+ + +HPYCC LH P CL Sbjct: 35 CLCDLYMHPYCCCDLHPYPYCL 56
>ODFP_HUMAN (Q14990) Outer dense fiber protein| Length = 250 Score = 28.9 bits (63), Expect = 4.9 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -3 Query: 66 CMSYVTVHPYCCA-LHMIPVCL 4 C+ + +HPYCC LH P CL Sbjct: 35 CLCDLYMHPYCCCDLHPYPYCL 56
>ODFP_RAT (P21769) Outer dense fiber protein (Protein RT7) (RTS 5/1)| Length = 245 Score = 28.9 bits (63), Expect = 4.9 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -3 Query: 66 CMSYVTVHPYCCA-LHMIPVCL 4 C+ + +HPYCC LH P CL Sbjct: 35 CLCDLYMHPYCCCDLHPYPYCL 56
>ATU_DROME (Q94546) Another transcription unit protein| Length = 725 Score = 28.9 bits (63), Expect = 4.9 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = -3 Query: 369 TPSSPRSERVGSLHSHESF*SPTMQKNNRSKLQPFGE*SLRMCGTARVR 223 TP SP+S R GSL S +S SP +++ + + G R G+A R Sbjct: 104 TPESPQSHRSGSLQSRKSG-SPQSRRSGSPQSRKSGSTHSRRSGSAHSR 151
>ODFP_PIG (Q29077) Outer dense fiber protein| Length = 262 Score = 28.9 bits (63), Expect = 4.9 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -3 Query: 66 CMSYVTVHPYCCA-LHMIPVCL 4 C+ + +HPYCC LH P CL Sbjct: 35 CLCDLYMHPYCCCDLHPYPYCL 56
>ODFP_BOVIN (Q29438) Outer dense fiber protein| Length = 262 Score = 28.9 bits (63), Expect = 4.9 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -3 Query: 66 CMSYVTVHPYCCA-LHMIPVCL 4 C+ + +HPYCC LH P CL Sbjct: 35 CLCDLYMHPYCCCDLHPYPYCL 56
>GCSPB_STAHJ (Q4L6N5) Probable glycine dehydrogenase [decarboxylating] subunit 2| (EC 1.4.4.2) (Glycine decarboxylase subunit 2) (Glycine cleavage system P-protein subunit 2) Length = 492 Score = 28.1 bits (61), Expect = 8.3 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -3 Query: 276 LQPFGE*SLRMCGTARVRNG--LRSIFSVHNFVPVIAFCLHPFVLLGAKVKQAVLR 115 ++ G LR A V N +++ H +P +C H FVL G+K K+ +R Sbjct: 342 IRTMGAEGLREVSEAAVLNANYIKASLKDHYEIPYEQYCKHEFVLSGSKQKEHGVR 397 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,770,516 Number of Sequences: 219361 Number of extensions: 1198042 Number of successful extensions: 2578 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2572 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)