| Clone Name | rbastl46f01 |
|---|---|
| Clone Library Name | barley_pub |
>K125_TOBAC (O23826) 125 kDa kinesin-related protein| Length = 1006 Score = 64.3 bits (155), Expect = 1e-10 Identities = 33/49 (67%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = -2 Query: 466 PSKGTIESLRAMPIESLMDEFRENHPYES--SKEPKPSLIPRSPLATLN 326 PSK TIESLRAMP+E L++EFREN+ +ES KE KPSLIPRSP + +N Sbjct: 957 PSKVTIESLRAMPMEVLLEEFRENNSFESFQVKEVKPSLIPRSPFSQIN 1005
>K125_ARATH (P82266) Probable 125 kDa kinesin-related protein| Length = 1056 Score = 61.6 bits (148), Expect = 9e-10 Identities = 31/48 (64%), Positives = 39/48 (81%), Gaps = 2/48 (4%) Frame = -2 Query: 466 PSKGTIESLRAMPIESLMDEFRENHPYES--SKEPKPSLIPRSPLATL 329 P+K TIESLRAMPIE+L++EFREN+ YES +KE KP + RSPL+ L Sbjct: 961 PTKATIESLRAMPIETLVEEFRENNSYESFATKETKPQQLTRSPLSQL 1008
>DLL3_HUMAN (Q9NYJ7) Delta-like protein 3 precursor (Drosophila Delta homolog| 3) Length = 618 Score = 35.8 bits (81), Expect = 0.056 Identities = 27/109 (24%), Positives = 39/109 (35%), Gaps = 30/109 (27%) Frame = -2 Query: 250 CPCCARFYGM---LALIQCLLHSC*NVSICCGAAE---------------YSCKKFYDEC 125 C C FYG+ ++ + C C N +C G A+ +C+K D C Sbjct: 298 CTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRC 357 Query: 124 LLHSC*NVSIC------------CGAAEYSCKKFYDECLLHSC*NVSIC 14 L C N +C G A C+ D+C +C N C Sbjct: 358 SLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTC 406
>DLL3_MOUSE (O88516) Delta-like protein 3 precursor (Drosophila Delta homolog| 3) (M-Delta-3) Length = 592 Score = 33.9 bits (76), Expect = 0.21 Identities = 26/109 (23%), Positives = 38/109 (34%), Gaps = 30/109 (27%) Frame = -2 Query: 250 CPCCARFYGM---LALIQCLLHSC*NVSICCGAAE---------------YSCKKFYDEC 125 C C FYG+ ++ + C C N +C G + +C+K D C Sbjct: 296 CACPRGFYGLRCEVSGVTCADGPCFNGGLCVGGEDPDSAYVCHCPPGFQGSNCEKRVDRC 355 Query: 124 LLHSC*NVSIC------------CGAAEYSCKKFYDECLLHSC*NVSIC 14 L C N +C G A C+ D+C +C N C Sbjct: 356 SLQPCQNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTC 404
>DLLA_BRARE (Q6DI48) Delta-like protein A precursor (DeltaA protein)| Length = 772 Score = 33.5 bits (75), Expect = 0.28 Identities = 27/107 (25%), Positives = 37/107 (34%), Gaps = 28/107 (26%) Frame = -2 Query: 250 CPCCARFYGM---LALIQCLLHSC*NVSICC-------------GAAEYSCKKFYDECLL 119 C C FYG L+ + C C N C G A ++C+K D C Sbjct: 354 CTCPPGFYGKNCELSAMTCADGPCFNGGRCADNPDGGYFCQCPTGYAGFNCEKKIDHCSS 413 Query: 118 HSC*NVSICC------------GAAEYSCKKFYDECLLHSC*NVSIC 14 C N + C G +C + DEC ++ C N C Sbjct: 414 SPCSNGARCVDLVNSYLCQCPDGFTGMNCDRAGDECSMYPCQNGGTC 460
>NOTC2_RAT (Q9QW30) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 32.3 bits (72), Expect = 0.62 Identities = 27/109 (24%), Positives = 40/109 (36%), Gaps = 30/109 (27%) Frame = -2 Query: 250 CPCCARFYGMLA---LIQCLLHSC*NVSICCGAAEYS-------------CKKFYDECLL 119 C C RF G + C C N C +++ C++ D+C Sbjct: 207 CQCPQRFTGQHCDSPYVPCAPSPCVNGGTCRQTGDFTSECHCLPGFEGSNCERNIDDCPN 266 Query: 118 HSC*NVSICC-GAAEYSCK-----------KFYDECLL--HSC*NVSIC 14 H C N +C G Y+C+ + DECLL ++C N C Sbjct: 267 HKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTC 315 Score = 28.9 bits (63), Expect = 6.8 Identities = 28/106 (26%), Positives = 34/106 (32%), Gaps = 27/106 (25%) Frame = -2 Query: 250 CPCCARFYGMLA---LIQCLLHSC*NVSICC------------GAAEYSCKKFYDECLLH 116 C C F GM + CL + C N C G C+ +ECL Sbjct: 897 CECPPGFSGMDCEEDINDCLANPCQNGGSCVDKVNTFSCLCLPGFVGDKCQTDMNECLSE 956 Query: 115 SC*NVSIC----------CGAAEYS--CKKFYDECLLHSC*NVSIC 14 C N C C A + C+ DEC SC N C Sbjct: 957 PCKNGGTCSDYVNSYTCTCPAGFHGVHCENNIDECTESSCFNGGTC 1002
>SLIT1_RAT (O88279) Slit homolog 1 protein precursor (Slit-1) (Multiple| epidermal growth factor-like domains 4) Length = 1531 Score = 32.0 bits (71), Expect = 0.80 Identities = 27/108 (25%), Positives = 41/108 (37%), Gaps = 29/108 (26%) Frame = -2 Query: 250 CPCCARFYGMLALIQ---CLLHSC*NVSICC-GAAEYSCK-----------KFYDECL-- 122 C C + F G+ + C+ H C N +C G Y+C+ + D C Sbjct: 991 CSCPSGFEGLTCGMNTDDCVKHDCVNGGVCVDGIGNYTCQCPLQYTGRACEQLVDFCSPD 1050 Query: 121 LHSC*NVSICCGAAEY------------SCKKFYDECLLHSC*NVSIC 14 L+ C + + C G E +C K D+C H C N + C Sbjct: 1051 LNPCQHEAQCVGTPEGPRCECVPGYTGDNCSKNQDDCKDHQCQNGAQC 1098
>NOTCH_DROME (P07207) Neurogenic locus Notch protein precursor| Length = 2703 Score = 31.2 bits (69), Expect = 1.4 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = -2 Query: 151 SCKKFYDECLLHSC*NVSICC-GAAEYSCK 65 +C++ YD+CL H C N C G ++Y+C+ Sbjct: 289 NCEQNYDDCLGHLCQNGGTCIDGISDYTCR 318 Score = 28.5 bits (62), Expect = 8.9 Identities = 18/57 (31%), Positives = 23/57 (40%), Gaps = 12/57 (21%) Frame = -2 Query: 148 CKKFYDECLLHSC*NVSICCGAAE-YSC---KKFY--------DECLLHSC*NVSIC 14 C+K DEC+ C N +C Y C + FY DEC + C N C Sbjct: 712 CEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRC 768
>DLL3_RAT (O88671) Delta-like protein 3 precursor (Drosophila Delta homolog| 3) Length = 589 Score = 31.2 bits (69), Expect = 1.4 Identities = 25/109 (22%), Positives = 37/109 (33%), Gaps = 30/109 (27%) Frame = -2 Query: 250 CPCCARFYGM---LALIQCLLHSC*NVSICCGAAE---------------YSCKKFYDEC 125 C C FYG ++ + C C N +C G + +C++ D C Sbjct: 300 CACPRGFYGPRCEVSGVTCADGPCFNGGLCVGGEDPDSAYVCHCPPAFQGSNCERRVDRC 359 Query: 124 LLHSC*NVSIC------------CGAAEYSCKKFYDECLLHSC*NVSIC 14 L C N +C G A C+ D+C +C N C Sbjct: 360 SLQPCQNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTC 408
>PALA_SCHPO (Q09807) pH-response regulator protein palA/rim20| Length = 701 Score = 30.4 bits (67), Expect = 2.3 Identities = 13/53 (24%), Positives = 35/53 (66%), Gaps = 6/53 (11%) Frame = +1 Query: 67 YKNIRRLHNKLIHSSRNAKDTRHRIFYKNIRRLHNKL------IHSSKNAKDT 207 Y++ + +++I+S +++++ + + FY ++ +LH ++ + +S+NAKDT Sbjct: 439 YRHCCQALDEIINSVKSSQNMKEKGFYSDVIKLHEEVSLLKVNVENSQNAKDT 491 Score = 29.3 bits (64), Expect = 5.2 Identities = 12/45 (26%), Positives = 31/45 (68%), Gaps = 6/45 (13%) Frame = +1 Query: 13 NKLIHSSRNAKDTRHRIFYKNIRRLHNKL------IHSSRNAKDT 129 +++I+S +++++ + + FY ++ +LH ++ + +S+NAKDT Sbjct: 447 DEIINSVKSSQNMKEKGFYSDVIKLHEEVSLLKVNVENSQNAKDT 491
>CUBN_CANFA (Q9TU53) Cubilin precursor| Length = 3620 Score = 30.4 bits (67), Expect = 2.3 Identities = 25/87 (28%), Positives = 32/87 (36%), Gaps = 11/87 (12%) Frame = -2 Query: 241 CARFYGMLALIQCLLHSC*NVSICCGAAEYSCKKFYDECLLHSC*NVS--------IC-- 92 C+ G L L CL N G C + D CL H C N +C Sbjct: 363 CSSVLGSLPLCTCLPGYTGN-----GYGPNGCAQLSDTCLSHPCLNGQCIETVSGYLCKC 417 Query: 91 -CGAAEYSCKKFYDECLLHSC*NVSIC 14 G A +C + +ECL + C N C Sbjct: 418 ESGWAGINCTENINECLSNPCFNGGTC 444
>NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (hN2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 30.0 bits (66), Expect = 3.1 Identities = 26/109 (23%), Positives = 39/109 (35%), Gaps = 30/109 (27%) Frame = -2 Query: 250 CPCCARFYGMLA---LIQCLLHSC*NVSICCGAAEYS-------------CKKFYDECLL 119 C C F G + C C N C +++ C++ D+C Sbjct: 207 CQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPN 266 Query: 118 HSC*NVSICC-GAAEYSCK-----------KFYDECLL--HSC*NVSIC 14 H C N +C G Y+C+ + DECLL ++C N C Sbjct: 267 HRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTC 315
>NOTC1_HUMAN (P46531) Neurogenic locus notch homolog protein 1 precursor (Notch 1)| (hN1) (Translocation-associated notch protein TAN-1) [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2556 Score = 30.0 bits (66), Expect = 3.1 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 12/57 (21%) Frame = -2 Query: 148 CKKFYDECLLHSC*NVSICCG-AAEYSCK-----------KFYDECLLHSC*NVSIC 14 C+ DEC C N + C YSCK + DECL H C N C Sbjct: 1143 CEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTC 1199
>NOTCH_XENLA (P21783) Neurogenic locus notch protein homolog precursor (XOTCH| protein) Length = 2524 Score = 29.6 bits (65), Expect = 4.0 Identities = 20/72 (27%), Positives = 28/72 (38%), Gaps = 15/72 (20%) Frame = -2 Query: 184 NVSICCGAAEYS---CKKFYDECLLHSC*NVSIC------------CGAAEYSCKKFYDE 50 N C A Y+ C++ DEC + C N + C G +C + +E Sbjct: 1126 NTHFCRCQAGYTGSYCEEQVDECSPNPCQNGATCTDYLGGYSCECVAGYHGVNCSEEINE 1185 Query: 49 CLLHSC*NVSIC 14 CL H C N C Sbjct: 1186 CLSHPCQNGGTC 1197
>NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (Motch B) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2470 Score = 29.6 bits (65), Expect = 4.0 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 14/60 (23%) Frame = -2 Query: 151 SCKKFYDECLLHSC*NVSICC-GAAEYSCK-----------KFYDECLL--HSC*NVSIC 14 +C++ D+C H C N +C G Y+C+ + DECLL ++C N C Sbjct: 254 TCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTC 313
>Y244_BUCAP (Q8K9R6) UPF0125 protein BUsg244| Length = 95 Score = 29.3 bits (64), Expect = 5.2 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 64 FYKNIRRLHNKLIHSSRNAKDTRHRIFYKNI 156 FYKN ++NKL+H + N K+ Y+N+ Sbjct: 47 FYKNNVGIYNKLVHLNENVKNGDRIEIYRNL 77
>GSTP_DIRIM (P46426) Glutathione S-transferase (EC 2.5.1.18) (GST class-pi)| Length = 208 Score = 29.3 bits (64), Expect = 5.2 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +1 Query: 22 IHSSRNAKDTRHRIFYKNIRRLHNKLIHSSRNAKDTRHRIFYKNI 156 ++ NA+ + +FY+ IR LH+K A +T+ F KNI Sbjct: 76 LNGENNAETSYVDMFYEGIRDLHSKYTRMIYEAYETQKDPFIKNI 120
>NOTC1_BRARE (P46530) Neurogenic locus notch homolog protein 1 precursor| Length = 2437 Score = 28.9 bits (63), Expect = 6.8 Identities = 26/99 (26%), Positives = 37/99 (37%), Gaps = 20/99 (20%) Frame = -2 Query: 250 CPCCARFYGMLALIQCLLHS-----C*NVSICCGAAEYS---CKKFYDECLLHSC*NVSI 95 C AR G+ + C H+ N +C A Y+ C++ DEC + C N + Sbjct: 1099 CEVAARQQGVSVAVLCR-HAGQCVDAGNTHLCRCQAGYTGSYCQEQVDECQPNPCQNGAT 1157 Query: 94 CC------------GAAEYSCKKFYDECLLHSC*NVSIC 14 C G +C K +ECL C N C Sbjct: 1158 CTDYLGGYSCECVPGYHGMNCSKEINECLSQPCQNGGTC 1196
>HELS_METJA (Q58524) Putative ski2-type helicase (EC 3.6.1.-) [Contains:| Endonuclease PI-MjaHel (EC 3.1.-.-) (Mja Hel intein) (Mja Pep3 intein)] Length = 1195 Score = 28.9 bits (63), Expect = 6.8 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 85 LHNKLIHSSRNAKDTRHRIFYKNIRRLHNKLIHSSKNAKD 204 LH K R +K H I+ K +R++ NKL +K+ K+ Sbjct: 490 LHKKYFLKCRISKGVAHYIYSKKLRKIFNKLNMLTKDNKN 529
>MT1X_HUMAN (P80297) Metallothionein-1X (MT-1X) (Metallothionein-IX) (MT-IX)| Length = 61 Score = 28.5 bits (62), Expect = 8.9 Identities = 18/61 (29%), Positives = 20/61 (32%) Frame = -2 Query: 193 SC*NVSICCGAAEYSCKKFYDECLLHSC*NVSICCGAAEYSCKKFYDECLLHSC*NVSIC 14 SC V C A CK EC SC CC C K C+ + C Sbjct: 6 SCSPVGSCACAGSCKCK----ECKCTSC--KKSCCSCCPVGCAKCAQGCICKGTSDKCSC 59 Query: 13 C 11 C Sbjct: 60 C 60
>HIS8_BLOFL (Q7VQW9) Histidinol-phosphate aminotransferase (EC 2.6.1.9)| (Imidazole acetol-phosphate transaminase) Length = 356 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = -3 Query: 201 FCILARMYQFVVEPPNILVKNSMTSVFCIPARMYQFVVEPPNILVKNSMTSV 46 FC A + Q + E PN+++ +++ F + F + P I+ N +T V Sbjct: 187 FCRHASLIQLLTEYPNLIILRTLSKAFALAGLRCGFTLANPKII--NLLTKV 236
>PRP4B_HUMAN (Q13523) Serine/threonine-protein kinase PRP4 homolog (EC 2.7.11.1)| (PRP4 pre-mRNA-processing factor 4 homolog) (PRP4 kinase) Length = 1007 Score = 28.5 bits (62), Expect = 8.9 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +1 Query: 43 KDTRHRIFYKNIRRLHNKLIHSSRNAKDTRHRIFYKNIRRLHNKLIHSS 189 K +RH+ R H K HSS KD +H+ +K+ + ++I +S Sbjct: 39 KHSRHKKKKHKHRSKHKKHKHSSEEDKDKKHKHKHKHKKHKRKEVIDAS 87
>CRUM1_MOUSE (Q8VHS2) Crumbs homolog 1 precursor| Length = 1405 Score = 28.5 bits (62), Expect = 8.9 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = -2 Query: 181 VSICC-GAAEYSCKKFYDECLLHSC*NVSICCG-AAEYSCKKFYDE 50 V IC G C++ DECLLH C N C Y+C +D+ Sbjct: 381 VCICQPGFTGIHCEEDVDECLLHPCLNGGTCENLPGNYACHCPFDD 426
>SLIT1_MOUSE (Q80TR4) Slit homolog 1 protein precursor (Slit-1)| Length = 1531 Score = 28.5 bits (62), Expect = 8.9 Identities = 24/108 (22%), Positives = 41/108 (37%), Gaps = 29/108 (26%) Frame = -2 Query: 250 CPCCARFYGMLALIQ---CLLHSC*NVSICC-GAAEYSCK-----------KFYDECL-- 122 C C + F G + C+ H+C N +C G Y+C+ + D C Sbjct: 991 CSCPSGFEGPTCGVDTDDCVKHACVNGGVCVDGVGNYTCQCPLQYTGRACEQLVDFCSPD 1050 Query: 121 LHSC*NVSICCGAAEY------------SCKKFYDECLLHSC*NVSIC 14 ++ C + + C G + +C + D+C H C N + C Sbjct: 1051 MNPCQHEAQCVGTPDGPRCECMLGYTGDNCSENQDDCKDHKCQNGAQC 1098
>EAA3_CAEEL (Q21353) Putative sodium-dependent excitatory amino acid| transporter glt-3 Length = 532 Score = 28.5 bits (62), Expect = 8.9 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 11/37 (29%) Frame = +2 Query: 344 RARDERRLG-----------FLARFIGMVLTELIHQG 421 RARD RR+G FLA F G++L IH G Sbjct: 70 RARDARRIGIVTIIYYMITTFLATFTGIILVSSIHPG 106
>DL_DROME (P10041) Neurogenic locus protein delta precursor| Length = 833 Score = 28.5 bits (62), Expect = 8.9 Identities = 26/103 (25%), Positives = 32/103 (31%), Gaps = 24/103 (23%) Frame = -2 Query: 250 CPCCARFYGM---LALIQCLLHSC*NVSIC---------CGAAEYSCKKFYDECLLHSC* 107 C C + G L L C + C N C G + C+ D+CL H C Sbjct: 404 CECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSGKCICPAGFSGTRCETNIDDCLGHQCE 463 Query: 106 NVSICC------------GAAEYSCKKFYDECLLHSC*NVSIC 14 N C G C D CL+ C N C Sbjct: 464 NGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTC 506 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,745,971 Number of Sequences: 219361 Number of extensions: 1319778 Number of successful extensions: 3680 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 2897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3625 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)