| Clone Name | rbastl45a04 |
|---|---|
| Clone Library Name | barley_pub |
>EX7L_XANAC (Q8PJW7) Probable exodeoxyribonuclease VII large subunit (EC| 3.1.11.6) (Exonuclease VII large subunit) Length = 445 Score = 30.4 bits (67), Expect = 1.1 Identities = 18/60 (30%), Positives = 28/60 (46%) Frame = +2 Query: 11 HILGLKWRRITRSATKL*THNPKQQTDRWAQISILLHLQSTGSLKQQHEQRQVEGITDRL 190 H+L R+ R +L +HNP++ Q LH Q+ + QH+Q Q+ I L Sbjct: 331 HVLERLQARVQRGQAQLQSHNPQRHLAGLQQRLRALHPQAAMQRRLQHDQLQLRRIARSL 390
>KR510_HUMAN (Q6L8G5) Keratin-associated protein 5-10 (Keratin-associated| protein 5.10) (Ultrahigh sulfur keratin-associated protein 5.10) Length = 202 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -2 Query: 174 PSTCRCSCCCFRLPVLCRCSRIEICAHLSVCC 79 P C+ SCC +PV C+ S + C S CC Sbjct: 165 PCCCQSSCC---VPVCCQSSCCKPCCCQSSCC 193
>KRA52_HUMAN (Q701N4) Keratin-associated protein 5-2 (Keratin-associated protein| 5.2) (Ultrahigh sulfur keratin-associated protein 5.2) (Keratin-associated protein 5-8) (Keratin-associated protein 5.8) Length = 177 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -2 Query: 174 PSTCRCSCCCFRLPVLCRCSRIEICAHLSVCC 79 P C+ SCC +PV C+ S + C S CC Sbjct: 140 PCCCQSSCC---VPVCCQSSCCKPCCCQSNCC 168
>HSP90_EIMTE (O44001) Heat shock protein 90| Length = 713 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 72 IQSNRQTDGHKSLFCCTYKALEV*NSSMNNDKSKELQTD 188 +Q ++ D HK L CCT + LE+ S K +EL+ + Sbjct: 514 VQQLKEFDNHK-LRCCTKEGLEIDESEEEKKKFEELKAE 551
>EPL1_ASPFU (Q4WDF1) Enhancer of polycomb-like protein 1| Length = 582 Score = 28.5 bits (62), Expect = 4.3 Identities = 16/62 (25%), Positives = 30/62 (48%) Frame = +2 Query: 137 SLKQQHEQRQVEGITDRLTEENYGFFVLDEEP*KRNSEVAASERPTRR*SQYPNQPPLRS 316 ++K E + +T + F L E+P K+ +E A++RPT + P +P ++ Sbjct: 295 NIKDDDEDLINQKVTSIPARLPHAFANLPEQPKKKPAEAPAAQRPTAPQIRMPQKPGTQA 354 Query: 317 GD 322 D Sbjct: 355 AD 356
>SPA4L_HUMAN (Q8TC36) Sperm-associated antigen 4-like protein (Testis and| spermatogenesis-related gene 4 protein) Length = 379 Score = 28.1 bits (61), Expect = 5.6 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 180 VIPSTCRCSCCCFRLPVLCRCSRIEICAHLSVCCFGLWVYN 58 V+ +TCRC C +L +E L +C FG W+++ Sbjct: 87 VLFNTCRCKLLCQKL--------MEKTGILLLCAFGFWMFS 119
>KR415_HUMAN (Q9BYQ5) Keratin-associated protein 4-15 (Keratin-associated| protein 4.15) (Ultrahigh sulfur keratin-associated protein 4.15) (Fragment) Length = 193 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = -2 Query: 174 PSTCRCSC----CCFRLPVLCRCSRIEICAHLSVCC 79 P+ CR SC CC + RC R + C SVCC Sbjct: 90 PTCCRPSCSISSCCRPSCCVSRCCRSQCCQ--SVCC 123
>Y208_BACHD (Q9KGA4) Hypothetical protein BH0208| Length = 459 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 104 ISILLHLQSTGSLKQQHEQRQVEGITDRL 190 + I+LHL G K++ +++VEGI D L Sbjct: 422 VGIVLHLMLIGLKKEELTEKEVEGIKDDL 450
>KRA47_HUMAN (Q9BYR0) Keratin-associated protein 4-7 (Keratin-associated protein| 4.7) (Ultrahigh sulfur keratin-associated protein 4.7) Length = 210 Score = 27.3 bits (59), Expect = 9.5 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -2 Query: 177 IPSTCRCSCCCFRLPVLCRCSRIEICAHLSVCC 79 I S CR SCC + RC R + C SVCC Sbjct: 116 ISSCCRPSCC------VSRCCRPQCCQ--SVCC 140
>V002_FOWPV (Q9ICF9) Hypothetical protein FPV002/FPV259| Length = 222 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 183 SVIPSTCRC-SCCCFRLPVLCRCSRIEICAHLSVCCF 76 SV P+TC+C C + V C C + + CC+ Sbjct: 24 SVRPATCKCVHCLLYPFEVCCECMSETLDSLEHSCCY 60
>NPT2B_PONPY (Q5REV9) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 689 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -2 Query: 165 CRCSCCCFRLPVLCRCSRIEICAHLSVCC 79 C C CC +LC C + C S CC Sbjct: 619 CCCRVCCRACCLLCGCPK---CCRCSKCC 644
>NPT2B_HUMAN (O95436) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 690 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -2 Query: 165 CRCSCCCFRLPVLCRCSRIEICAHLSVCC 79 C C CC +LC C + C S CC Sbjct: 620 CCCRVCCRACCLLCGCPK---CCRCSKCC 645 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,514,646 Number of Sequences: 219361 Number of extensions: 989224 Number of successful extensions: 2634 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2629 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)