| Clone Name | rbastl44g05 |
|---|---|
| Clone Library Name | barley_pub |
>VN53_ROTPC (Q00033) Nonstructural RNA-binding protein 53 (NS53) (NCVP2)| Length = 393 Score = 30.4 bits (67), Expect = 1.1 Identities = 17/67 (25%), Positives = 29/67 (43%) Frame = -3 Query: 237 NLYKPSLWWFGRSVCMSLEAPDFQGYNKKTNQRLVREY*CADTIKQYVSRDR*SSSICNC 58 N Y+ L+WFG+++ +L + G+ K+ ++ C D K Y S C Sbjct: 3 NSYREMLYWFGKTIDRNLPYVNTNGWRKQKGRKDGICLNCLDECKLY------SCDHCGI 56 Query: 57 SVQCNGC 37 +C C Sbjct: 57 KHKCGNC 63
>RL5_PYRKO (Q5JJG1) 50S ribosomal protein L5P| Length = 183 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 231 YKPSLWWFGRSVCMSLEAPDFQGYNKKTNQRLV 133 Y P + FG VC++LE P F+ +K +R + Sbjct: 125 YDPEIGIFGMDVCVTLERPGFRVAKRKRQRRKI 157
>BLM10_YEAST (P43583) Proteasome activator BLM10 (Bleomycin resistance protein| BLM10) Length = 2143 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = -3 Query: 237 NLYKPSLWWFGRSVCMSLEAPDFQGYNKKTNQRLVREY*CADTIKQYVS 91 N+Y PS WF RSV +F Y ++++ + Y C + Y++ Sbjct: 103 NIYDPSSRWFSRSVRPEFPIEEFLPYKTESHEDQAK-YLCHVLVNLYIA 150
>LAX5_MEDTR (Q8L883) Auxin transporter-like protein 5 (AUX1-like protein 5)| (MtLAX5) Length = 490 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -2 Query: 301 SSDYKERELMNLVKIEGRWIN*FVQTIIVVVW*ISLYELGGSGFPG 164 SS ++ + K GRW+ FV + +VVW + + G GF G Sbjct: 399 SSSARQNAVEQPPKFVGRWVGTFVINVFIVVWVL----IVGFGFGG 440
>F16P_HAEIN (P45292) Fructose-1,6-bisphosphatase (EC 3.1.3.11)| (D-fructose-1,6-bisphosphate 1-phosphohydrolase) (FBPase) Length = 333 Score = 28.1 bits (61), Expect = 5.6 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Frame = +3 Query: 111 YRHTSTLSLIVDLFFYYNPGNPEPPSSYKLIYQTTTMMVCT-----N*LIHRPSIFT 266 YR S + V L + PGN + + Y ++Y ++TM+V T N + PSI T Sbjct: 133 YRRVSPIGSPVTLEDFMQPGNKQVAAGY-IVYGSSTMLVYTTGNGVNGFTYDPSIGT 188
>RL5_PYRFU (Q8U012) 50S ribosomal protein L5P| Length = 186 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 231 YKPSLWWFGRSVCMSLEAPDFQGYNKK 151 Y P + FG VC++LE P F+ +K Sbjct: 128 YDPEIGIFGMDVCVTLERPGFRVARRK 154
>RL5_PYRHO (O59431) 50S ribosomal protein L5P| Length = 188 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 231 YKPSLWWFGRSVCMSLEAPDFQGYNKK 151 Y P + FG VC++LE P F+ +K Sbjct: 128 YDPEIGIFGMDVCVTLERPGFRVARRK 154
>RL5_PYRAB (Q9V1U9) 50S ribosomal protein L5P| Length = 188 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 231 YKPSLWWFGRSVCMSLEAPDFQGYNKK 151 Y P + FG VC++LE P F+ +K Sbjct: 128 YDPEIGIFGMDVCVTLERPGFRVARRK 154 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,025,779 Number of Sequences: 219361 Number of extensions: 974292 Number of successful extensions: 1904 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1904 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)