| Clone Name | rbastl44c10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-as... | 28 | 5.3 | 2 | ISPD_ECO57 (Q8X7Y4) 2-C-methyl-D-erythritol 4-phosphate cytidyly... | 27 | 9.1 | 3 | NOL6_XENLA (Q6NRY2) Nucleolar protein 6 | 27 | 9.1 |
|---|
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = -1 Query: 302 NAKPRVC----CQRGFSVVGAIAPPMCIHPVTCFVVCADDFG 189 + KP C CQ+ V P+C PV C C+DD G Sbjct: 213 SCKPACCTSSPCQQACCV------PVCCKPVCCVPTCSDDSG 248
>ISPD_ECO57 (Q8X7Y4) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase| (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) Length = 235 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 53 GRHQVQQHTIWTLLLREKVKATNIAASPG 139 G + +H+++ LL +VK IA SPG Sbjct: 32 GNQTILEHSVYALLAHPRVKRVVIAISPG 60
>NOL6_XENLA (Q6NRY2) Nucleolar protein 6| Length = 1147 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +2 Query: 254 HQQQKTLAGSKPLAWRSTTTEQL*HLYSEQCRPRKISNAYVHGA 385 HQQ G+ LA R ++ L +SE+C +++ ++H A Sbjct: 844 HQQHPAFGGTSRLAKRWIQSQLLGDSFSEECLDLLVAHLFLHPA 887 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,900,657 Number of Sequences: 219361 Number of extensions: 1206926 Number of successful extensions: 3146 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3067 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3144 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)