| Clone Name | rbastl44a09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PFA3_GIBZE (Q4IA62) Palmitoyltransferase PFA3 (EC 2.3.1.-) (Prot... | 32 | 0.36 | 2 | YSR4_CAEEL (Q09952) Hypothetical protein F59B10.4 | 31 | 0.81 | 3 | EXON_VZVD (P09253) Alkaline exonuclease (EC 3.1.11.-) | 27 | 8.9 | 4 | ATKA_PSESM (Q883V6) Potassium-transporting ATPase A chain (EC 3.... | 27 | 8.9 |
|---|
>PFA3_GIBZE (Q4IA62) Palmitoyltransferase PFA3 (EC 2.3.1.-) (Protein fatty| acyltransferase 3) Length = 550 Score = 32.0 bits (71), Expect = 0.36 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -1 Query: 268 LFCILLYAVLVCWRWYEQSYRNQ*WGYEGSLLVLNFYIL 152 LFC +AV CW WYE + Y S L +NF +L Sbjct: 164 LFCFWSFAVSACWVWYEALNDQE---YIDSFLPVNFIML 199
>YSR4_CAEEL (Q09952) Hypothetical protein F59B10.4| Length = 267 Score = 30.8 bits (68), Expect = 0.81 Identities = 18/61 (29%), Positives = 32/61 (52%) Frame = -1 Query: 268 LFCILLYAVLVCWRWYEQSYRNQ*WGYEGSLLVLNFYILLMQGYQASSKVESVWLAAIIW 89 LF ++LY + Y S+ +L ++NF ++L+ +SKV S+ L A++W Sbjct: 55 LFAVMLYLI------YPDSF------LPSTLFIVNFSLVLLALLGINSKVSSMILPALVW 102 Query: 88 K 86 K Sbjct: 103 K 103
>EXON_VZVD (P09253) Alkaline exonuclease (EC 3.1.11.-)| Length = 551 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 11 GANNPFPFQSKIDFGTTKSKANSLLFPDNSS*PYG 115 G NP P ++ I F K +A L PD+ + P G Sbjct: 271 GTLNPHPAETDISFFEIKCRAKYLFDPDDKNNPLG 305
>ATKA_PSESM (Q883V6) Potassium-transporting ATPase A chain (EC 3.6.3.12)| (Potassium-translocating ATPase A chain) (ATP phosphohydrolase [potassium-transporting] A chain) (Potassium-binding and translocating subunit A) Length = 564 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 7/59 (11%) Frame = -1 Query: 178 LLVLNFYILLM-------QGYQASSKVESVWLAAIIWKQERVCFGFCGAEIDFRLERKW 23 LL+L F +LL+ + + + E WL+ ++ ER C+ G +D + E+ W Sbjct: 7 LLILAFLVLLLAPAPWLGRFFYRVMEGERTWLSPVLGPVERACYLISG--VDPKTEQSW 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,734,503 Number of Sequences: 219361 Number of extensions: 1066574 Number of successful extensions: 2369 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2369 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)