| Clone Name | rbastl44a05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TIM21_GIBZE (Q4HZ95) Import inner membrane translocase subunit T... | 31 | 1.9 | 2 | TIM21_ASPFU (Q4X1I8) Import inner membrane translocase subunit t... | 30 | 3.2 | 3 | THYG_RAT (P06882) Thyroglobulin precursor | 30 | 4.2 | 4 | Y1688_HALSA (Q06847) Hypothetical protein Vng1688c | 29 | 7.2 | 5 | APBB2_MOUSE (Q9DBR4) Amyloid beta A4 precursor protein-binding f... | 28 | 9.4 |
|---|
>TIM21_GIBZE (Q4HZ95) Import inner membrane translocase subunit TIM21,| mitochondrial precursor Length = 229 Score = 30.8 bits (68), Expect = 1.9 Identities = 21/81 (25%), Positives = 39/81 (48%), Gaps = 6/81 (7%) Frame = +3 Query: 108 TEEGQKRSIFTVNRASPQIQWPLLFFKTISENATLQSASW------MGLSGGQVYSVFCE 269 T G KR T + + W L + AT QS ++ + L+GG Y ++ + Sbjct: 40 TPRGPKRRAVTPFNDNGHVPWKQLSVAEKAARATQQSFNFGMILVGLMLTGGVGYFLWTD 99 Query: 270 IASPNLRKSSASDALDELAQD 332 + SP+ + S+ + A+D++ D Sbjct: 100 VFSPDSKISNFNRAVDKIRSD 120
>TIM21_ASPFU (Q4X1I8) Import inner membrane translocase subunit tim21,| mitochondrial precursor Length = 237 Score = 30.0 bits (66), Expect = 3.2 Identities = 23/94 (24%), Positives = 40/94 (42%), Gaps = 6/94 (6%) Frame = +3 Query: 69 TKGRPKRREKTAKTEEGQKRSIFTVNRASPQIQWPLLFFKTISENATLQSASWMG----- 233 +K P+RR T +++G+ +W L + AT QS +++ Sbjct: 47 SKATPRRRNVTVLSDDGR-------------YEWGELSGREKVARATQQSLNFLVIVAGA 93 Query: 234 -LSGGQVYSVFCEIASPNLRKSSASDALDELAQD 332 L+GG Y ++ E+ SPN R A+ + D Sbjct: 94 VLTGGVFYLLYTEVFSPNSRTWQFEKAVQRIKDD 127
>THYG_RAT (P06882) Thyroglobulin precursor| Length = 2768 Score = 29.6 bits (65), Expect = 4.2 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 384 VDDWGDAVFGGASGQTRQLRTCTTSCIVGRS 476 VD WG+ + G ++ Q+ C TSC + R+ Sbjct: 1053 VDGWGELIPGSLMARSSQMPQCPTSCELSRA 1083
>Y1688_HALSA (Q06847) Hypothetical protein Vng1688c| Length = 283 Score = 28.9 bits (63), Expect = 7.2 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +3 Query: 240 GGQVYSVFCEIASPNLRKSSASDALDELAQDRALAPLRLT 359 GG V +V A+P + A D DELA L PLRL+ Sbjct: 54 GGFVETVLRYAATPPYLRKEAFDTRDELAYAGVLPPLRLS 93
>APBB2_MOUSE (Q9DBR4) Amyloid beta A4 precursor protein-binding family B member| 2 Length = 760 Score = 28.5 bits (62), Expect = 9.4 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -2 Query: 443 PQLPGLPRSAPEDG-VAPVVHGPELRE 366 PQ P P+S+PEDG VA V PE ++ Sbjct: 208 PQKPNKPQSSPEDGQVATVSSSPETKK 234 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,156,798 Number of Sequences: 219361 Number of extensions: 1037989 Number of successful extensions: 3845 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3837 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)