| Clone Name | rbastl43g01 |
|---|---|
| Clone Library Name | barley_pub |
>COPB_DICDI (Q23924) Probable coatomer subunit beta (Beta-coat protein)| (Beta-COP) (Fragment) Length = 400 Score = 53.9 bits (128), Expect = 2e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 442 LVNISIEKQVDGKLSGYIRIRSKTQGIALSLGDKI 338 L NI IEKQ DGK+SGYIRIR+K Q IA++LG+KI Sbjct: 359 LANICIEKQADGKISGYIRIRAKVQSIAVTLGEKI 393
>COPB_DROME (P45437) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 964 Score = 52.0 bits (123), Expect = 7e-07 Identities = 27/43 (62%), Positives = 35/43 (81%), Gaps = 3/43 (6%) Frame = -3 Query: 442 LVNISIEKQVD---GKLSGYIRIRSKTQGIALSLGDKITLKQK 323 L N+SIEK VD K++G+IRIR+K+QG+ALSLGDKI+ QK Sbjct: 916 LANLSIEKPVDDPDSKVTGHIRIRAKSQGMALSLGDKISSSQK 958
>COPB_RAT (P23514) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 51.6 bits (122), Expect = 9e-07 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 4/44 (9%) Frame = -3 Query: 442 LVNISIEKQV----DGKLSGYIRIRSKTQGIALSLGDKITLKQK 323 L N+SIEK V D ++G+IRIR+K+QG+ALSLGDKI L QK Sbjct: 906 LANVSIEKPVHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949
>COPB_MOUSE (Q9JIF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 51.6 bits (122), Expect = 9e-07 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 4/44 (9%) Frame = -3 Query: 442 LVNISIEKQV----DGKLSGYIRIRSKTQGIALSLGDKITLKQK 323 L N+SIEK V D ++G+IRIR+K+QG+ALSLGDKI L QK Sbjct: 906 LANVSIEKPVHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQK 949
>COPB_SCHPO (Q9UUF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 940 Score = 49.3 bits (116), Expect = 4e-06 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -3 Query: 442 LVNISIEKQVDGKLSGYIRIRSKTQGIALSLG 347 L+++S+EK V G +SG++RIRSKTQGIALSLG Sbjct: 906 LMSLSVEKSVSGPISGHVRIRSKTQGIALSLG 937
>COPB_HUMAN (P53618) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 44.7 bits (104), Expect = 1e-04 Identities = 24/44 (54%), Positives = 32/44 (72%), Gaps = 4/44 (9%) Frame = -3 Query: 442 LVNISIEKQV----DGKLSGYIRIRSKTQGIALSLGDKITLKQK 323 L N+S EK + D ++ +IRIR+K+QG+ALSLGDKI L QK Sbjct: 906 LANVSSEKPLHQGPDAAVTVHIRIRAKSQGMALSLGDKINLSQK 949
>COPB_YEAST (P41810) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 973 Score = 42.0 bits (97), Expect = 7e-04 Identities = 24/43 (55%), Positives = 30/43 (69%), Gaps = 3/43 (6%) Frame = -3 Query: 442 LVNISIEKQVDGKLS---GYIRIRSKTQGIALSLGDKITLKQK 323 L N+ IEK D K + GY+RIRSK QG+ALSLGD++ L K Sbjct: 923 LANLCIEK--DSKTNDVIGYVRIRSKGQGLALSLGDRVALIAK 963
>HISX_BLOFL (Q7VQX0) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 437 Score = 30.0 bits (66), Expect = 2.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 121 RCNDLSQLPSMTRPFLTKNGGVRIDVKFVL 32 RC+ QL +TRP N + +DVK++L Sbjct: 14 RCSISEQLTLLTRPINKHNNSIHLDVKYIL 43 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,455,548 Number of Sequences: 219361 Number of extensions: 1028293 Number of successful extensions: 2579 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2579 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)