| Clone Name | rbastl43f07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ALR2_ECOLI (P29012) Alanine racemase, catabolic (EC 5.1.1.1) | 30 | 1.4 | 2 | ALR2_ECO57 (Q8X4I9) Alanine racemase, catabolic (EC 5.1.1.1) | 30 | 1.4 | 3 | ALR2_SALTY (P06191) Alanine racemase, catabolic (EC 5.1.1.1) | 29 | 3.0 | 4 | ALR2_SALTI (Q8Z688) Alanine racemase, catabolic (EC 5.1.1.1) | 29 | 3.0 | 5 | SYA_LACPL (Q88V10) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine-... | 28 | 6.7 |
|---|
>ALR2_ECOLI (P29012) Alanine racemase, catabolic (EC 5.1.1.1)| Length = 356 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 169 AKQAIICRISLTNLSKTLWHPHA 101 A + + CR SL+N + TLWHP A Sbjct: 179 AAEGLECRRSLSNSAATLWHPEA 201
>ALR2_ECO57 (Q8X4I9) Alanine racemase, catabolic (EC 5.1.1.1)| Length = 356 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 169 AKQAIICRISLTNLSKTLWHPHA 101 A + + CR SL+N + TLWHP A Sbjct: 179 AAEGLECRRSLSNSAATLWHPEA 201
>ALR2_SALTY (P06191) Alanine racemase, catabolic (EC 5.1.1.1)| Length = 356 Score = 29.3 bits (64), Expect = 3.0 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 172 VAKQAIICRISLTNLSKTLWHPHA 101 +A + + C SL+N + TLWHP A Sbjct: 178 LATEGLQCAYSLSNSAATLWHPQA 201
>ALR2_SALTI (Q8Z688) Alanine racemase, catabolic (EC 5.1.1.1)| Length = 356 Score = 29.3 bits (64), Expect = 3.0 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 172 VAKQAIICRISLTNLSKTLWHPHA 101 +A + + C SL+N + TLWHP A Sbjct: 178 LATEGLQCAYSLSNSAATLWHPQA 201
>SYA_LACPL (Q88V10) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 880 Score = 28.1 bits (61), Expect = 6.7 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +1 Query: 28 RYIKIIVAIPIGQYSNEANGTTKLRHGGAIGFWRGLS 138 +Y KI+ + IG YS E +G T +++ +G ++ +S Sbjct: 652 KYGKIVRVVSIGDYSIEFDGGTHVKNSSELGLFKIVS 688 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,680,753 Number of Sequences: 219361 Number of extensions: 520398 Number of successful extensions: 2100 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2093 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2100 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)