| Clone Name | rbastl43f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MTH1_DROME (Q9VXD9) Probable G-protein coupled receptor Mth-like... | 31 | 1.2 | 2 | MCH1_GIBZE (Q4IM48) Probable transporter MCH1 | 28 | 7.7 |
|---|
>MTH1_DROME (Q9VXD9) Probable G-protein coupled receptor Mth-like 1 precursor| (Protein methuselah-like 1) Length = 676 Score = 31.2 bits (69), Expect = 1.2 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 249 NKQTQIFTSPHRPLGFMICENTALGVSPSESVLATLW 359 N+ IF + P+G ++C N AL VS + + LW Sbjct: 484 NRNLSIFAYFYGPIGLLLCANIALFVSTTHQLTCGLW 520
>MCH1_GIBZE (Q4IM48) Probable transporter MCH1| Length = 572 Score = 28.5 bits (62), Expect = 7.7 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -1 Query: 247 VSHPWGLPNLFIQHIFMSLCSCCL 176 V + W LP L + +F+ + +CCL Sbjct: 151 VDNDWSLPFLMLSFVFVGVATCCL 174 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,090,888 Number of Sequences: 219361 Number of extensions: 1146614 Number of successful extensions: 1914 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1912 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)