| Clone Name | rbastl43e10 |
|---|---|
| Clone Library Name | barley_pub |
>NUP98_RAT (P49793) Nuclear pore complex protein Nup98 (Nucleoporin Nup98) (98| kDa nucleoporin) Length = 937 Score = 35.4 bits (80), Expect = 0.035 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -2 Query: 352 EQGVEFISFDAAKGEWKFKVKHFSSYGFAEAE 257 +QG +F + G W FKV HFS YG +++ Sbjct: 857 KQGAQFKEYRPETGSWVFKVSHFSKYGLQDSD 888
>NUP98_HUMAN (P52948) Nuclear pore complex protein Nup98-Nup96 precursor| [Contains: Nuclear pore complex protein Nup98 (Nucleoporin Nup98) (98 kDa nucleoporin); Nuclear pore complex protein Nup96 (Nucleoporin Nup96) (96 kDa nucleoporin)] Length = 1729 Score = 35.4 bits (80), Expect = 0.035 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -2 Query: 352 EQGVEFISFDAAKGEWKFKVKHFSSYGFAEAE 257 +QG +F + G W FKV HFS YG +++ Sbjct: 858 KQGAQFKEYRPETGSWVFKVSHFSKYGLQDSD 889
>NU145_YEAST (P49687) Nucleoporin NUP145 precursor (EC 3.4.21.-) (Nuclear pore| protein NUP145) [Contains: Nucleoporin NUP145N (N-NUP145); Nucleoporin NUP145C (C-NUP145)] Length = 1317 Score = 32.7 bits (73), Expect = 0.23 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 343 VEFISFDAAKGEWKFKVKHFSSYGFAEAEVGLID 242 + +IS++ G W FKV HFS +G E ID Sbjct: 586 MNYISYNPFGGTWTFKVNHFSIWGLVNEEDAEID 619
>NU189_SCHPO (Q9UTK4) Nucleoporin nup189 (Nuclear pore protein nup189)| Length = 1778 Score = 32.7 bits (73), Expect = 0.23 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -2 Query: 340 EFISFDAAKGEWKFKVKHFSSYGFAEAE 257 EFI F+ G+W FKV+HFS YG + E Sbjct: 918 EFIDFN--DGKWIFKVQHFSRYGLLDDE 943
>CE290_HUMAN (O15078) Centrosomal protein Cep290| Length = 1539 Score = 29.3 bits (64), Expect = 2.5 Identities = 20/85 (23%), Positives = 39/85 (45%) Frame = +3 Query: 18 LYFRQETTINSLIQSTHTHTHSTKLAQGCALHKQERFVQNIETKDKPHSIIQKTKASQ*E 197 L ++ ++ SLI H H S +L++ AL K E ++ K + +++ + K + E Sbjct: 248 LDYQAQSDEKSLIAKLHQHNVSLQLSEATALGKLESITSKLQ-KMEAYNLRLEQKLDEKE 306 Query: 198 SSKISYNFHGRGYMESIRPTSASAK 272 + GR + +R T S + Sbjct: 307 QALYYARLEGRNRAKHLRQTIQSLR 331
>DSBD_HAEIN (P44919) Thiol:disulfide interchange protein dsbD precursor (EC| 1.8.1.8) (Protein-disulfide reductase) (Disulfide reductase) (C-type cytochrome biogenesis protein cycZ) Length = 579 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +2 Query: 182 SVTMRVLQNQLQLPWTGLHGIDQAYFSFSKTIGAEVLHLELPLALSSVKRDELH 343 S T+ ++QLQ W I Y+ + I AE++ PL+L + + ELH Sbjct: 38 SATLSTDKSQLQAHWD----IADGYYLYQDKISAELVGKSNPLSLHTQQAAELH 87
>STAB2_RAT (Q8CFM6) Stabilin-2 precursor (Hyaluronan receptor for endocytosis)| [Contains: 175 kDa stabilin-2 (175 kDa hyaluronan receptor for endocytosis)] (Fragment) Length = 1431 Score = 27.3 bits (59), Expect = 9.5 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +1 Query: 148 KISHIALFKKQKRHNESPPKSVTTSMDGATWNRSGL 255 +IS + Q+RH +SPP + + +++ W + L Sbjct: 1376 RISQTLCMRPQRRHPQSPPVTPSQTLENRIWRTATL 1411
>NARZ_ECOLI (P19319) Respiratory nitrate reductase 2 alpha chain (EC 1.7.99.4)| Length = 1245 Score = 27.3 bits (59), Expect = 9.5 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +3 Query: 72 HTHSTKLAQGCALHKQERFVQNIETKDKPHSIIQKTKASQ*ESSKISYN 218 HTH ALHK++ ++ + + +P II S ES +SYN Sbjct: 981 HTH-------LALHKEDEKIRFRDIQAQPRKIISSPTWSGLESDHVSYN 1022
>NODD2_RHISN (P55700) Nodulation protein D II| Length = 312 Score = 27.3 bits (59), Expect = 9.5 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 7/50 (14%) Frame = +2 Query: 179 KSVTMRVLQNQLQLP-------WTGLHGIDQAYFSFSKTIGAEVLHLELP 307 K+ +RV + L LP W LH DQA + + E LH+ P Sbjct: 255 KTTPLRVAELPLALPPFAQAVQWPSLHNRDQASIWMRQVLLQEALHMTAP 304
>NOD22_BRAJA (P12233) Nodulation protein D II| Length = 312 Score = 27.3 bits (59), Expect = 9.5 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 7/50 (14%) Frame = +2 Query: 179 KSVTMRVLQNQLQLP-------WTGLHGIDQAYFSFSKTIGAEVLHLELP 307 K+ +RV + L LP W LH DQA + + E LH+ P Sbjct: 255 KTTPLRVAELPLALPPFAQAVQWPSLHNRDQASIWMRQVLLQEALHMTTP 304
>INSL7_DROME (Q9W4Q9) Probable insulin-like peptide 7 precursor (Insulin-related| peptide) (DILP7) [Contains: Probable insulin-like peptide 7 A chain; Probable insulin-like peptide 7 B chain] Length = 159 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/64 (26%), Positives = 32/64 (50%) Frame = +1 Query: 49 HLYNPHTHTHIVLN*RRVAHSTNKKDLYKT*KRKISHIALFKKQKRHNESPPKSVTTSMD 228 ++++ TH+ R + +KD+Y+ +R KK+ ++E+ K TT D Sbjct: 53 NVWHQETHSRCRDKLVRQLYWACEKDIYRLTRRN-------KKRTGNDEAWIKKTTTEPD 105 Query: 229 GATW 240 G+TW Sbjct: 106 GSTW 109 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,231,828 Number of Sequences: 219361 Number of extensions: 779448 Number of successful extensions: 1814 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1812 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)