| Clone Name | rbastl43c07 |
|---|---|
| Clone Library Name | barley_pub |
>GIDA_BUCAP (O51879) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gidA (Glucose-inhibited division protein A) Length = 631 Score = 32.0 bits (71), Expect = 0.81 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 243 LQLTDAPYKTDTAGRTEPPHLDINLWNMQGLLMHFVSVP 359 L+L D P++ D PP +DIN N + L + VP Sbjct: 187 LRLRDLPFRVDRLKTGTPPRIDINTINFENLFVQHGDVP 225
>RP8L3_ARATH (Q9FJB5) Probable disease resistance RPP8-like protein 3| Length = 901 Score = 30.0 bits (66), Expect = 3.1 Identities = 15/51 (29%), Positives = 31/51 (60%) Frame = -1 Query: 464 IISLPKLGKVPQGIESLRSLKKLTLKYLHKDFRSHWDTNEMHQKTLHVPEV 312 I S KL ++P G++ + SLK+L ++ + ++++ E + K H+P+V Sbjct: 841 IHSCEKLEELPDGLKYVTSLKELKIEGMKREWKEKL-VGEDYYKVQHIPDV 890
>GRK5_HUMAN (P34947) G protein-coupled receptor kinase 5 (EC 2.7.11.16) (G| protein-coupled receptor kinase GRK5) Length = 590 Score = 29.3 bits (64), Expect = 5.2 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 174 RQMLMTTSIYNHKFAETIKSTTQLQLT 254 R++L T +Y+HKF+E KS ++ LT Sbjct: 399 RRVLETEEVYSHKFSEEAKSICKMLLT 425
>GRK5_BOVIN (P43249) G protein-coupled receptor kinase 5 (EC 2.7.11.16) (G| protein-coupled receptor kinase GRK5) Length = 590 Score = 29.3 bits (64), Expect = 5.2 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 174 RQMLMTTSIYNHKFAETIKSTTQLQLT 254 R++L T +Y+HKF+E KS ++ LT Sbjct: 399 RRVLETEEVYSHKFSEEAKSICKMLLT 425
>TAF1_DROME (P51123) Transcription initiation factor TFIID subunit 1 (EC| 2.7.11.1) (Transcription initiation factor TFIID 230 kDa subunit) (TAFII-230) (TAFII250) (TBP-associated factor 230 kDa) (p230) Length = 2129 Score = 29.3 bits (64), Expect = 5.2 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = +3 Query: 231 STTQLQLTDAPYKTDTAGRTEPPHLDINLWNMQGLLMHFVSVPMTSEILVQ 383 S +Q+ + D+ + T +PP LD L H V PM SE L Q Sbjct: 2065 SQSQIYMVDSSNEPTTLDYQQPPQLDFQQVQEMEQLQHQVMPPMQSEQLQQ 2115
>DRL13_ARATH (Q9XIF0) Putative disease resistance protein At1g59780| Length = 906 Score = 28.9 bits (63), Expect = 6.8 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -1 Query: 464 IISLPKLGKVPQGIESLRSLKKLTLKYLHKDFRSHWDT-NEMHQKTLHVP 318 I+ KL ++P G+ + SLK+L ++ K F+ E + K HVP Sbjct: 833 IVDCKKLKEIPDGLRFISSLKELAIRTNEKVFQKKVSKGGEDYYKMQHVP 882
>TIMP1_SHEEP (P50122) Metalloproteinase inhibitor 1 precursor (TIMP-1)| Length = 207 Score = 28.9 bits (63), Expect = 6.8 Identities = 25/82 (30%), Positives = 36/82 (43%), Gaps = 2/82 (2%) Frame = +3 Query: 213 FAETIKSTTQLQLTDAPYKTDTAGRTEPPHLDINLWNMQGLLM-HFVSVPMTSEI-LVQI 386 FA T+ L AP + T PPH N + ++ FV +E L Q Sbjct: 4 FAPTVSGILLLLWLTAPSRACTC---VPPHPQTAFCNSEVVIRAKFVGTAEVNETALYQR 60 Query: 387 LQCKLLKGAEGFNALRDLTKLR 452 + K+ K +GF+ALRD +R Sbjct: 61 YEIKMTKMFKGFSALRDAPDIR 82
>RP8L4_ARATH (Q9FJK8) Probable disease resistance RPP8-like protein 4| Length = 908 Score = 28.9 bits (63), Expect = 6.8 Identities = 13/47 (27%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = -1 Query: 449 KLGKVPQGIESLRSLKKLTLKYLHKDFRSHW-DTNEMHQKTLHVPEV 312 KL ++P G++ + SLK+L ++ + ++++ E + K H+P+V Sbjct: 855 KLKELPDGLKYITSLKELKIREMKREWKEKLVPGGEDYYKVQHIPDV 901
>MATK_HELBU (Q9XPN6) Maturase K (Intron maturase)| Length = 515 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +3 Query: 297 PHLDINLWNMQGLLMHFVSVPMTSEILVQILQCKL 401 P L+ L ++ +L + P+ EILVQILQC++ Sbjct: 140 PFLEDKLSHLNYVLDILIPYPIHLEILVQILQCRI 174 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,868,637 Number of Sequences: 219361 Number of extensions: 1277919 Number of successful extensions: 3019 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3019 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)