| Clone Name | rbastl43c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | W_HENDV (P0C1C6) Protein W | 29 | 6.3 | 2 | PHOSP_HENDV (O55778) Phosphoprotein (Protein P) | 29 | 6.3 | 3 | V_HENDV (O55777) Nonstructural protein V | 29 | 6.3 | 4 | DUT_HHV6U (Q06095) Deoxyuridine 5'-triphosphate nucleotidohydrol... | 28 | 8.2 | 5 | DUT_HHV6G (P30007) Deoxyuridine 5'-triphosphate nucleotidohydrol... | 28 | 8.2 |
|---|
>W_HENDV (P0C1C6) Protein W| Length = 448 Score = 28.9 bits (63), Expect = 6.3 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +3 Query: 99 PSSETERFMTWHVLQRHDGTTE-TPHTKEGPNNP 197 PSS ER ++H+ HDG P TK PN P Sbjct: 128 PSSSPERGWSYHMSGTHDGNVRAVPDTKVLPNAP 161
>PHOSP_HENDV (O55778) Phosphoprotein (Protein P)| Length = 707 Score = 28.9 bits (63), Expect = 6.3 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +3 Query: 99 PSSETERFMTWHVLQRHDGTTE-TPHTKEGPNNP 197 PSS ER ++H+ HDG P TK PN P Sbjct: 128 PSSSPERGWSYHMSGTHDGNVRAVPDTKVLPNAP 161
>V_HENDV (O55777) Nonstructural protein V| Length = 457 Score = 28.9 bits (63), Expect = 6.3 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +3 Query: 99 PSSETERFMTWHVLQRHDGTTE-TPHTKEGPNNP 197 PSS ER ++H+ HDG P TK PN P Sbjct: 128 PSSSPERGWSYHMSGTHDGNVRAVPDTKVLPNAP 161
>DUT_HHV6U (Q06095) Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC| 3.6.1.23) (dUTPase) (dUTP pyrophosphatase) Length = 376 Score = 28.5 bits (62), Expect = 8.2 Identities = 18/61 (29%), Positives = 31/61 (50%) Frame = -1 Query: 326 SKLVKMLGLILK*MFILQADTVLCSHPKLFDEPEASCRVVTEIWIVRAFFCMWSFCCAVV 147 SK + LGL+++ +I DT+ K+F+ + + T I I R F FC +++ Sbjct: 293 SKEIAKLGLLIE-TYIWNKDTI--PSIKIFNSTRKTIYIPTGICIARIIFTCGHFCLSLM 349 Query: 146 P 144 P Sbjct: 350 P 350
>DUT_HHV6G (P30007) Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC| 3.6.1.23) (dUTPase) (dUTP pyrophosphatase) Length = 376 Score = 28.5 bits (62), Expect = 8.2 Identities = 18/61 (29%), Positives = 31/61 (50%) Frame = -1 Query: 326 SKLVKMLGLILK*MFILQADTVLCSHPKLFDEPEASCRVVTEIWIVRAFFCMWSFCCAVV 147 SK + LGL+++ +I DT+ K+F+ + + T I I R F FC +++ Sbjct: 293 SKEIAKLGLLIE-TYIWNKDTI--PSIKIFNSTRKTIYIPTGICIARIIFTCGHFCLSLM 349 Query: 146 P 144 P Sbjct: 350 P 350 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,446,411 Number of Sequences: 219361 Number of extensions: 1227349 Number of successful extensions: 3190 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3190 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)