| Clone Name | rbastl43b07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | STP2_PANPA (Q9N1A6) Nuclear transition protein 2 (TP-2) (TP2) (F... | 30 | 2.5 | 2 | YDBA_ECOLI (P33666) Hypothetical protein ydbA | 30 | 2.5 | 3 | ATG12_NEUCR (Q7S083) Autophagy-related protein 12 (Autophagy-rel... | 28 | 9.7 | 4 | YQBO_BACSU (P45931) Hypothetical protein yqbO | 28 | 9.7 | 5 | DCTD_RHILE (P10046) C4-dicarboxylate transport transcriptional r... | 28 | 9.7 |
|---|
>STP2_PANPA (Q9N1A6) Nuclear transition protein 2 (TP-2) (TP2) (Fragment)| Length = 133 Score = 30.0 bits (66), Expect = 2.5 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 9/65 (13%) Frame = +2 Query: 41 TKHGSFPVTHIQ-------QICPSTRARQ--AQLCRSAHNGLHCSHAPEFYTTYKLIAAA 193 TK S P+TH Q Q C T RQ +Q CR +H G + + +++ A Sbjct: 3 TKTHSLPITHTQLHSNSQPQSCTCTHHRQTFSQSCRQSHRGSRSRSSSQSPASHRNPTGA 62 Query: 194 QSPDG 208 S G Sbjct: 63 HSSSG 67
>YDBA_ECOLI (P33666) Hypothetical protein ydbA| Length = 2003 Score = 30.0 bits (66), Expect = 2.5 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +2 Query: 275 TWPDDESRRRTVHLLPVPPTGLLDRQQLVADDPREAPEPP 394 T PDDES PVPPT D +++ DDP + P PP Sbjct: 105 TPPDDESDDT-----PVPPTPGGD--EIIPDDPDDTPTPP 137
>ATG12_NEUCR (Q7S083) Autophagy-related protein 12 (Autophagy-related| ubiquitin-like modifier atg-12) Length = 157 Score = 28.1 bits (61), Expect = 9.7 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 36 ARPSTVHFQSHTSSKSVRPHEQGRHSSAAQLTMVCTAVM 152 A PS VH ++ +S + P +GR S LTM + V+ Sbjct: 11 ASPSLVHDDNNPNSSTASPVLEGRDSPNLPLTMTASTVL 49
>YQBO_BACSU (P45931) Hypothetical protein yqbO| Length = 1585 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 351 SSSSQMIHGKLQNRLFPGWWWSG 419 SS Q + GKL++ LF WWSG Sbjct: 922 SSVWQSVKGKLKSTLFSEKWWSG 944
>DCTD_RHILE (P10046) C4-dicarboxylate transport transcriptional regulatory| protein dctD Length = 448 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 19 D*PPAKPDQARFISSHTHPANL 84 D PP PD R ++SHT P N+ Sbjct: 341 DVPPLSPDVRRHLASHTWPGNV 362 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,500,411 Number of Sequences: 219361 Number of extensions: 1432918 Number of successful extensions: 4100 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4098 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)